(data stored in ACNUC7421 zone)

EMBL: AP011115.PE364

AP011115.PE364       Location/Qualifiers
FT   CDS_pept        371130..371561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03640"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48611"
FT                   /db_xref="GOA:C1ARD4"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD4"
FT                   /protein_id="BAH48611.1"
FT                   /translation="MDPTFVIVGGATGALTAYVLPLWLIRSGRGPRLAAKREVSTAIDT
FT                   GALPPDADIWSWRPRLVESRQTVARGRWVMLAAGLLMSFVTLAHAVGEGGTLLTWVFVG
FT                   SAALSLVGAFGMHRQVRRADSLLAAISAGPTARPNFGAR"
     atggatccga ccttcgtgat cgtcggtggc gcgacaggcg ccctcaccgc atacgtcctg        60
     ccgctctggc tgatcagaag cggccgcggt ccgcggctgg ccgcgaaacg agaggtgtcg       120
     acggcgatcg acaccggcgc gctgccaccg gacgcagaca tctggtcatg gcgaccacgg       180
     ctggtggaga gccgacagac ggtcgcccgc ggtcgctggg tgatgcttgc cgccggtctc       240
     ctcatgtcat tcgtcacact cgcccatgcc gtcggcgagg gcggcacact cctgacgtgg       300
     gtgttcgtgg ggtcggccgc cttgtcactc gtcggtgcgt tcgggatgca tcgtcaggtg       360
     agacgagccg actctctgct cgcagccatc agcgcaggac caacggcgag accgaacttc       420
     ggtgcacgct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page