(data stored in ACNUC7421 zone)

EMBL: AP011115.PE365

AP011115.PE365       Location/Qualifiers
FT   CDS_pept        371680..372369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48612"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD5"
FT                   /protein_id="BAH48612.1"
FT                   /translation="MRRVVRAFWGPRPEPVEALAGRWRLTLERVSQLLPVGGEWRQVHA
FT                   SEPDTACAPDELTAVLLVAQDTEAWSDRTGTGLRLVCTGEAGWAVELSGVAGGTPQFLL
FT                   QSLVMTVEAPEDAVVPESELLAMLAAVWEPDFGDVTDDDILDALEDDAGFVVGDPVVGR
FT                   FGYLCSARAVLIPDGLEASGPAVPDGGVLLHIAASGEIDTVVRVYERLRDAGALAPLAR
FT                   PLDRPTL"
     atgcgacgcg tcgtgcgggc cttctggggg ccgcggccgg aaccggtcga agcgctggcg        60
     gggcgatggc ggcttacgtt ggaacgagtc tcgcagctgc taccggtagg aggcgagtgg       120
     cggcaggtgc acgcgtcgga accggatacc gcatgtgcgc cggatgagct gacggcggtt       180
     cttctggtcg cgcaggatac cgaggcgtgg tcggatcgga cggggaccgg gttgcggttg       240
     gtgtgtaccg gtgaggccgg gtgggcggtc gaactctccg gcgtggccgg aggcaccccg       300
     caatttctgc tgcagtcact ggtgatgacg gtcgaggcgc ccgaagatgc cgtcgtcccc       360
     gaatccgaac tgctcgcgat gctcgcggcg gtgtgggaac cggacttcgg cgacgtgacc       420
     gacgacgaca tcctcgacgc tctcgaagac gatgccggat tcgtcgtcgg cgatccggtc       480
     gtcggccggt tcggctacct gtgctctgcc cgcgcagtgt tgatacccga cggcctggag       540
     gcgagcggtc cggctgttcc ggacggcggc gtgcttctgc acatcgccgc gtcgggtgag       600
     atcgacacgg tggttcgcgt gtacgagcgg ctgcgggacg cgggtgcgct cgcaccgctc       660
     gcacgaccgc tggaccggcc gacgctgtga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page