(data stored in ACNUC7421 zone)

EMBL: AP011115.PE366

AP011115.PE366       Location/Qualifiers
FT   CDS_pept        complement(372400..374430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48613"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD6"
FT                   /protein_id="BAH48613.1"
FT                   /translation="MEFPMLSKGQNLSLPADVEQIDVVLGWTESDVEVDASALLLNVDG
FT                   KVRSDADFVFYNQPESTDGSVRFLGASGTEEGAQARIAIDLSTVPEDVHTVALGGSVAA
FT                   GGFGDLGKLALRVVDGAGHTLAEYVTADATTESAFVFGEVYRRNGDWKVRAVGQGWESG
FT                   LAGLATDFGVDIADDPDPELTESADAPSDRENSDGAVPTGSTGDAPQLVPELPTTPAAP
FT                   RKTATRGVRTTKRVVKKSKPLVFGLAEQDTWQPARLFSVIGVGAGEEQERRATSALIAT
FT                   MQAVRPFARAVCARVGAPAGTFEGYVEVAYARGETKVIPDAVLKVARGSRVWTGLLEVK
FT                   TGSGKLKKEQLENYLDVARKKKYDVVVSLSNDVPASAGELPVEVDRRKLAKVALRHLSW
FT                   AEVAHEARMLLSHGGIDDDLQSWVLAEFLRYLDHPRSGAVEFVDMGRHWVTVRDAVTAG
FT                   TLRAGDEKALTVADTWVSLSRHLALRLTAELGVTVKHVLPRRHSTDPAARNAAVAERLA
FT                   GDGVFEAVLRIPETAGDLVVIADVRTNKIRCRTTVEAPNEGTSGRRVSWLLKQLRDVPG
FT                   DVQVEAVFSERGNEACEHIEAVRVDPKVLTVGRSGDIVSFCLEQSFPMGGRRSGTAASF
FT                   ISSVTSSADGFYGTVVQQLREWVPAAPKQTEQPRAAAPEGE"
     gtggagtttc cgatgctgtc caaggggcag aacctgtccc tgcctgctga tgtggagcag        60
     atcgacgtgg tgctggggtg gaccgagtcg gacgtcgagg tcgacgcgtc ggcattgctg       120
     ctgaacgtgg acgggaaggt acgctccgac gccgatttcg tgttctacaa ccagccggag       180
     tcgaccgacg gatcggttcg gttcctgggt gcgagcggca ccgaggaggg tgcgcaggcg       240
     aggatcgcga tcgacctgtc caccgtgccg gaggatgtgc acaccgttgc cctgggaggc       300
     agtgtcgctg ccggcgggtt cggtgacctc ggaaaactcg ccctccgagt cgtcgacggt       360
     gccgggcaca cgctggcgga gtacgtcacc gccgacgcca ccaccgagtc ggcgttcgta       420
     ttcggcgagg tgtaccgccg caacggcgac tggaaggtcc gggcggtcgg gcagggctgg       480
     gagtccgggt tggcggggtt ggccacggac ttcggagtcg acatcgccga cgacccggac       540
     cccgaactca ccgagtccgc cgacgccccg tccgatcgtg agaattccga cggagcggtg       600
     ccgaccggct ccaccggcga cgccccgcaa ttggtgcccg aattgcccac cacaccggcc       660
     gcaccacgga aaacggcgac ccggggtgtt cgcaccacca agcgcgtggt gaagaagtcg       720
     aagccgctcg tattcggcct cgccgaacag gacacctggc agccggcccg gttgttctcg       780
     gtcatcggcg tcggcgcggg tgaggagcag gagcggcgtg ccacgtccgc gctgatcgcg       840
     acgatgcagg cggtgcgtcc gttcgcccgt gcggtgtgtg cccgagtggg ggctcccgcg       900
     ggcaccttcg aggggtacgt ggaggtggcg tacgcgcggg gcgagacgaa ggtcattccc       960
     gacgccgtgt tgaaggtcgc ccgcggcagc agggtgtgga ccggtctgct cgaggtcaag      1020
     accggcagcg gcaagctgaa gaaggagcaa ctcgagaact atctcgacgt ggctcggaag      1080
     aagaagtacg acgtggtggt cagtctgtcg aacgacgttc cggccagcgc gggggaattg      1140
     ccggtggagg tcgatcggcg caagctcgcc aaggtcgccc tacggcacct gtcgtgggcg      1200
     gaggtggcgc acgaggcgcg gatgttgctg tcccatggcg gaatcgacga tgatctccag      1260
     tcgtgggtcc ttgccgagtt cctgcgttat ctcgaccatc cgcgttccgg ggcggtcgag      1320
     ttcgtcgaca tgggaaggca ctgggtcacg gtccgcgacg cggtcaccgc cggcactctg      1380
     cgcgccggcg acgagaaggc cctcaccgtg gccgacacct gggtgtccct gtcccggcat      1440
     ctcgcgctgc gcctgaccgc cgagttgggg gtcaccgtca aacacgtcct gccgcgccgg      1500
     cacagcaccg atccggcggc ccgcaacgcc gccgtcgccg agcggttggc gggcgacggc      1560
     gtattcgagg ccgtcctgcg gatcccggag actgccgggg acctggtggt gatcgcggat      1620
     gtgcggacca acaagatccg ctgccggacc accgtggagg caccgaacga ggggacctcc      1680
     ggtcgccggg tgtcgtggct gctcaagcag ctcagggacg ttccgggcga cgtccaggtc      1740
     gaagccgtgt tctccgagcg ggggaacgag gcttgcgagc acatcgaggc ggtgcgggtc      1800
     gatccgaagg tgctcaccgt cggccggtcc ggggacattg tgtccttctg cctcgaacag      1860
     tcgttcccga tgggcggccg gaggtcggga acggcggcga gtttcatcag cagcgtgacg      1920
     tcctcggcgg acggtttcta cggaacagtg gtgcagcaac tgcgggaatg ggtgcctgct      1980
     gctcccaagc agaccgagca gccgagggct gcggcacccg aaggcgaata g               2031
//

If you have problems or comments...

PBIL Back to PBIL home page