(data stored in ACNUC7421 zone)

EMBL: AP011115.PE368

AP011115.PE368       Location/Qualifiers
FT   CDS_pept        377542..381390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48615"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD8"
FT                   /protein_id="BAH48615.1"
FT                   /translation="MQLEKRFEAMGRPSPRMVRPDCSSKRPHGGVTMNSDKHLKHLGEL
FT                   AVAVGIGLAVAPAGTAVAAPSVGDSSTSSSSDSSDQTSSDGRAADRSTDGASSDRTSSG
FT                   TSRTDSDSSSDGSRSSTTGDSTTDSQSTSGTDSQSTSGTDTQSTTDTESTSATSSDDVN
FT                   GSGATTPDISSTVNDGSMPDSGTTAGESEQAGSSSDATAPTAIDASGAAIAPADRPQER
FT                   ADTELSDSPASPAPVQGHDSAPQGSDPAPTPPTTPVTGSSGAALDPIMAEDPAARGPVP
FT                   NAPAAIQDAVPATASAPEITTIDGATALTGIASDTKADASQVVTQALAPSLPTAAVDVA
FT                   SSVVSKVLGALGLRPFLSNDPQVPIESPTFWALAAAWCRRQEKVFTADANPTLAAAPVT
FT                   TSEPIESVAVTSTASTLTSTASTGTSSTSTAGPTVGAPDRSTGVVLGSINTSGDQLGYT
FT                   VTGQPSRGTVTVDETGGFRYTPTQAARQVAALDPSADYTSFDSFTVTPTSGQTSTPVTV
FT                   QVPVSAARMQVAQSTTVGSNPSGAVFTGTRTYVANQGSKSVSVLDTNDTVVGTVTVGTS
FT                   PTGVAANPAGTRVYVTNSGSGNVSVIDTATNTVVATVKTGTTPSAVAVNPAGTRAYVTN
FT                   SGSGTVSVINTATNTVVGSPIKVGITPNAVAVSPDGTRVYVTNRSSNTVSVINTATNTV
FT                   VATIRTGTTPNAVAVNPTGTRAYVTNRANNTVSVIDTATNSVVTTVAVGSQPTAVRVSP
FT                   DGSAAYVVSNPDRLTVIDARTNTVVSTLSIDSPTESGDHSIALSADGSRMLVTDATDGR
FT                   VRAVTLTHVNSEPTMSWTADAPRPSDGAVVVTLVDPRDPDGDPLTFTNTAPGSGSVVSD
FT                   GMTFTYTPTAAARDLALQTPGEDADHFTIALADGQAVTNIVVTVAISPTEVPDILEVES
FT                   TTIAVGSGPTGVVTAEDRIYVVSDEGFVRVIDPETNTVVGAPIEVDWASSNIAATSTSV
FT                   YVNSPYTGAISVIDTSTGTVVDTIWVDPAPDYQGYSLAQELAVSPDGTRLYASGEDGTV
FT                   SVIDTATNTVIASQLLGSYSSLEVSADGRYLYGTSGATVSVIDTASLTRTAEITVGPEW
FT                   DLTRTSSEFADVSHSVTVVNGNRLYVTHHVSTVERATGSFSNGQFITDSQGRLWRVTGG
FT                   YGLVSVIDIDPASATYGSTLDTVRLTGDAQDLALSPDGGRAFVTAGDGRTIAVIDTATN
FT                   TVVGTFVTDGEGAVTGPYGPLRTVSISSDTLYVTDYNDGAMYAVTGALDGAPAAVLT"
     atgcaactcg agaagcgctt cgaggcgatg ggccggccca gcccccggat ggtgcgtccg        60
     gactgcagtt cgaagcgtcc tcatggagga gtaaccatga acagcgacaa gcacctcaag       120
     cacctcggcg agctggcggt ggcagtgggc atagggcttg cggtcgcgcc tgccggcacg       180
     gcggtagcag caccgtccgt cggcgactcg tccacgtcgt cgagttccga ctcctccgac       240
     caaacatcgt ccgacgggag agccgcggat cgatccacgg acggggcctc ttcggacagg       300
     acgtcatccg gcacatcgcg tacggactcg gattcgtcga gcgacggatc gcggtcgtcg       360
     acgaccggcg actcgaccac ggattcgcaa tccacgtccg gcacggattc gcaatccacg       420
     tccggcaccg atacccaatc cacaacggac accgaatcca catcagccac ctcgagcgac       480
     gacgtgaacg ggtccggcgc gacgacaccc gacatctcgt cgactgtgaa cgacggaagc       540
     atgccggact cgggcacgac agcaggcgag tccgagcagg ccggatcgag ttctgatgcc       600
     acggcaccga cagcgatcga cgcgtccggt gccgcgatcg cgccggccga ccggccccag       660
     gaacgagcgg acaccgaact gtcggattcg cccgcgtcac cggcccccgt ccagggtcac       720
     gacagcgcac cccagggcag cgaccctgcg ccgacccccc cgaccacccc ggtaacgggc       780
     agctccggcg cggcactcga ccccatcatg gcggaggacc cggcagcccg cggacccgtc       840
     ccgaacgcgc cggcagcgat tcaggacgca gttccagcga cggcgtcggc tcccgaaatc       900
     accacgatcg acggggcgac ggccctgaca ggcatagcgt ccgacaccaa agccgatgcg       960
     tcgcaggtcg tgacgcaggc attggccccg tccctcccca ctgcggcggt ggacgtcgca      1020
     tcgagtgtcg tgtcgaaggt gctcggcgcc ctcgggctgc gtccgttcct gtcgaatgac      1080
     ccacaggtac cgatcgagtc gccgacgttc tgggcgctgg ccgcggcatg gtgccgtcga      1140
     caggagaagg tgttcaccgc cgacgcgaac ccgacgctgg ctgccgcccc cgttacgacc      1200
     agcgagccga tcgaatcggt cgccgtcaca agcaccgcat ccacactcac gagcaccgca      1260
     tccaccggca ccagctccac atcgactgct gggccgaccg tcggtgcgcc cgaccgcagt      1320
     accggcgtgg ttctcggctc gatcaacacg tccggagacc aactcggcta cacggtcacc      1380
     ggacagccga gccgcggaac ggtcaccgtc gacgagaccg gcggcttcag gtacaccccc      1440
     acccaggcag cgcgccaggt ggccgccctg gacccgagcg ccgattacac ctcgttcgac      1500
     tcgttcaccg tcaccccgac ctccgggcag accagcaccc cggtgaccgt gcaggtgccg      1560
     gtgtcggcgg cccggatgca ggtcgcgcag tccaccaccg tcgggtccaa cccgtccggt      1620
     gcggtgttca ccggcaccag aacctatgtg gcaaaccagg gttcgaagag cgtctccgtg      1680
     ctcgacacaa acgacaccgt cgtcggcacg gtgaccgtcg gcacctcgcc gaccggcgtc      1740
     gcggccaacc cggccgggac ccgggtgtat gtgaccaaca gcggcagcgg aaacgtgtcg      1800
     gtgatcgaca ccgccaccaa caccgtcgtc gccaccgtca agaccggcac cacacccagc      1860
     gccgtcgccg tcaatcccgc cggcacccgc gcgtatgtca ccaacagcgg cagcggcacc      1920
     gtgtcggtga tcaacaccgc caccaacacc gtcgtcggat cccccatcaa ggtcggcatc      1980
     acaccgaatg ctgtcgccgt gagccccgac ggcacccgtg tatatgtcac caaccgcagc      2040
     agcaacacgg tgtcggtgat caacaccgcc accaacaccg tcgtcgccac catcagaacc      2100
     ggcaccacac ccaacgccgt cgcggtcaac cccaccggca cccgcgcgta cgtcaccaac      2160
     cgcgccaaca acaccgtctc ggtcatcgac actgccacca acagcgtcgt aaccaccgtc      2220
     gccgtcggtt cccagccgac cgccgtacgc gtctcccccg acggaagcgc ggcctatgtc      2280
     gtctccaatc cggacaggct gaccgtcatc gacgcacgca ccaacaccgt tgtgtccaca      2340
     ctctccatcg actcgcctac cgagtccggc gaccactcca tcgcgctgag tgccgatggt      2400
     tcccgaatgc tcgtcaccga tgcgacggac gggcgggtgc gggccgtgac gctcacccac      2460
     gtgaactccg aacccacaat gagctggaca gccgacgcac ctcggccgtc cgacggcgcc      2520
     gtcgtcgtca ccctcgtcga ccccagagac cccgacgggg acccgctgac cttcacgaac      2580
     accgcacccg ggtccggatc ggtcgtctcc gacggcatga cattcaccta caccccgacc      2640
     gccgccgccc gcgacctcgc cttgcaaaca ccgggagagg acgccgacca tttcaccatc      2700
     gcccttgccg acggccaggc cgtgacgaac atcgttgtca ccgttgccat ctcgccgacc      2760
     gaggtcccgg atatcctcga ggtcgagtcg accaccattg cggtcggaag cggtccgacc      2820
     ggcgtggtga cggccgagga ccgcatctac gtcgtcagcg acgagggctt cgtccgggtg      2880
     atcgatcccg agaccaacac ggtcgtcggt gcgccgatcg aggtcgactg ggcgtcgtcg      2940
     aacatcgcgg ccacctcgac gtcggtgtac gtcaacagcc cctataccgg cgccatctcg      3000
     gtgatcgaca cgagcaccgg caccgtcgtc gacacgatct gggttgaccc cgcccccgat      3060
     taccagggct attccctggc tcaggagttg gccgtcagtc ccgacgggac acgcctctac      3120
     gccagcggtg aggacggcac ggtgtcggtc atcgacaccg ccacgaacac cgtgatcgcc      3180
     tcccagctgc tcggctccta cagcagcctg gaagtcagtg cggacggccg ctacctgtac      3240
     ggcacgagcg gcgccaccgt cagtgtcatc gacaccgcct ccctgaccag gaccgcggag      3300
     atcaccgtcg gtcccgaatg ggacctcacc aggacgagca gcgaattcgc cgacgtttcg      3360
     cacagcgtca ccgtcgtgaa cgggaaccgg ctgtacgtca cccaccacgt cagcaccgtg      3420
     gaacgcgcca ccggcagctt ctccaacgga cagttcatca ccgacagcca gggccgcctg      3480
     tggcgcgtga cgggcggata cggactcgtc agcgtgatcg acatcgatcc ggcgagtgcc      3540
     acctacggca gcacgttgga taccgtgcga ctgaccggtg acgcgcagga cctggcgctg      3600
     agccccgacg gcggccgggc gttcgtcacc gccggtgacg ggcgcaccat tgcggtgatc      3660
     gacaccgcca cgaacaccgt cgtcgggacg ttcgtaaccg acggggaggg cgcggtcacc      3720
     gggccctacg gtccgttgcg gacggtgtcg atctcgagcg acacgctgta cgtcaccgac      3780
     tacaacgacg gcgcgatgta tgcagtcacc ggcgcactgg acggcgcacc cgccgctgtg      3840
     ctgacctga                                                              3849
//

If you have problems or comments...

PBIL Back to PBIL home page