(data stored in ACNUC7421 zone)

EMBL: AP011115.PE37

AP011115.PE37        Location/Qualifiers
FT   CDS_pept        complement(31545..31958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48284"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS35"
FT                   /protein_id="BAH48284.1"
FT                   /translation="MTLALSTTLHTSFADAVDRTRKALADQGFGVLTEIDMKATLKAKL
FT                   GEDMEDYLILGACNPPLAHRAVTVDRQIGLLLPCNVVVRADPNNPGAVLIDAMNPQVMV
FT                   QVADQPGLGGVADDATAALQAAIDSLGAGAAKD"
     atgacactcg cactgtcgac caccctgcac acctcgttcg ccgacgcggt ggaccgcacc        60
     cgcaaggccc tggccgatca gggtttcggt gtgctcaccg agatcgacat gaaggccacc       120
     ctgaaggcga agctgggtga ggacatggag gactacctga tcctcggtgc ctgcaatccg       180
     ccgctcgcgc accgcgcggt caccgtggac cggcagatcg ggctgctgct gccgtgcaac       240
     gtcgtcgtcc gcgccgaccc gaataatccg ggtgcggtgc tgatcgatgc gatgaacccg       300
     caggtgatgg tccaggtggc cgaccaaccc ggactcggcg gcgtcgccga cgacgccacc       360
     gccgcattgc aggccgccat cgactccttg ggcgcgggcg cagcgaagga ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page