(data stored in ACNUC7421 zone)

EMBL: AP011115.PE370

AP011115.PE370       Location/Qualifiers
FT   CDS_pept        complement(382108..383130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03700"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48617"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE0"
FT                   /protein_id="BAH48617.1"
FT                   /translation="MTQVRKSRQGARPWIRYLVGIVAVVVLAGCAAPDPLTPTVSGTYT
FT                   TRPMTNGAQIIPPTNNPPPEGPSPESCGALASLRPGPQPPPGQMPPGGALAEIASRGRL
FT                   IVGVDQNTNPFSFRDPTTGTLQGFDIDVAKEITKDIFGDPAKVEFRLLTSAGRFSALEQ
FT                   NDVDVVVHATAITCERARRVGFSTEYFRAFQRILVPRGSDITGPADLAGKRVCTFVDTT
FT                   SLPTVQRVAPEATIVAVPDWDDCLVTMQKRQADATSTSDALLAGLVSQDPHFQIVGPPM
FT                   EGEEHWGLAVNKYKDDLIRFVNGTLDRMRSDGTWMRLYDRWIAGSLGPIAGPPPATYRD
FT                   "
     atgacacaag tgcggaaatc gagacagggg gcgaggccct ggattcggta cctcgtcggg        60
     attgtcgctg tcgtcgtcct cgccggctgc gcggcacccg accctctcac cccgacggtc       120
     tcaggcacct acaccacccg gccgatgacg aacggcgcac agatcattcc gcccacgaac       180
     aatccgccgc ctgaaggacc gtcccccgag tcgtgcggag cgcttgcgag cctacggccc       240
     ggcccgcagc cgccgccggg gcagatgcca cccggtgggg cacttgccga gatcgcgtcg       300
     cgcggacggt tgatcgtcgg tgtcgaccag aacacgaacc cgttcagctt ccgcgacccg       360
     accacgggca ccctgcaggg cttcgacatc gacgtggcga aggagatcac caaggacatc       420
     ttcggcgacc cggcaaaagt cgaattccgg ctgctcacct cggccggccg gttctcggca       480
     ctcgagcaga acgacgtcga cgtcgtcgtt cacgccacgg cgatcacgtg cgaacgcgcc       540
     cgacgcgtcg gcttctccac cgagtacttt cgcgcatttc agcgaattct ggtcccgcgg       600
     ggttccgaca tcacggggcc ggcggacctg gccggaaagc gggtctgcac cttcgtcgac       660
     accacgtctc tccccacggt ccaacgagtc gcgccggagg ccacgatcgt cgccgtcccc       720
     gattgggacg actgcctcgt caccatgcag aaacggcagg ccgacgcgac cagcacctcc       780
     gacgcgctcc tggccggcct cgtgtcccag gacccgcatt ttcagatcgt gggaccaccg       840
     atggagggcg aggagcactg ggggctcgcc gtcaacaagt acaaggacga cctgatcagg       900
     ttcgtcaacg gcactctcga ccgcatgcgg tcggacggaa cgtggatgcg cctctacgac       960
     cggtggatcg ccggttcgct cgggccgatc gcaggcccac ctccggctac ctatcgagat      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page