(data stored in ACNUC7421 zone)

EMBL: AP011115.PE371

AP011115.PE371       Location/Qualifiers
FT   CDS_pept        complement(383130..384485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03710"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48618"
FT                   /db_xref="GOA:C1ARE1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE1"
FT                   /protein_id="BAH48618.1"
FT                   /translation="MQEGRMFHRGDHVAIETPTLDEGLLVEPEGRRPWVEFLTSTPGRL
FT                   TVLGVALIAVVIAAGVITSAAVGARQQRVEVLRTHTEPLANAAQALYSSLSIADAAATT
FT                   SFISGGGASTGAEQFTQAVGDASNALVTATNGVSSQDAESLALLSDVVRNLAEYFNLVA
FT                   TAQANDRAGNPVGVAYLSDASALMQDTILPLAEQLYVRQAEAVAETQTHTAQLPAAAFT
FT                   VTAAALVALVLAQLYLVRKSKRRFNPGLAVASLLMAGLLIWLIAGSLVSTSASEHARTE
FT                   GTQPINTVARARILAQQARADETLALLQRGADTQSEVDYTRHSQALSDELTRQLDSAHG
FT                   DVAADDLRDAETAREGWLAAHRDIEIALERGDYPTAAAIAAGSGSGTSAAKFAVMDAAL
FT                   RDAIDRLRDDEAAAVTDAYRSMSSLAIGSMIIGVSCGFAVGGGIWPRLNEYH"
     gtgcaggagg gccggatgtt ccaccgcggc gatcacgtcg ccatagaaac cccgacgctc        60
     gacgagggcc tgctcgtcga gcccgaaggc cgccgaccgt gggtcgaatt cctcacgtcg       120
     acgcccggac ggctgaccgt gctgggggtc gcgctcatcg ccgtcgtcat cgccgccggc       180
     gtgatcacct cggcggcggt cggcgcgcgg caacagcggg tcgaggtatt gcggacccac       240
     accgagccac tggcgaatgc cgcccaggcc ctctacagct cgctgtcgat cgccgatgcc       300
     gccgcgacta cgtccttcat ctccggtggc ggggcgagta ccggcgcgga gcagttcacc       360
     caggcggtgg gggacgcgtc gaacgccctg gtcacggcga ccaacggggt gtcctcacag       420
     gatgccgaat cgctggcact gttgtcggac gtcgtgcgca acctcgccga gtacttcaac       480
     ctcgtcgcca ctgctcaggc gaacgatcgg gccggaaacc cggtcggggt ggcatatctg       540
     tccgatgcct ccgcgctcat gcaggacacc atcctcccgc tggcggagca gctctacgtc       600
     cgtcaggccg aggcggtcgc cgagacccag acgcacacgg cccaactgcc cgcggccgcg       660
     ttcacggtga ccgcagccgc cctcgtcgcg ctcgttctcg cccagttgta tctcgtccgg       720
     aagagcaagc gccggttcaa ccccggcctc gcggtagcgt cgctcctcat ggcgggactc       780
     ctgatctggc tgatcgccgg aagcctggtg tcgacgtcgg cgagcgaaca cgcgagaacc       840
     gaaggaacgc aacccatcaa cactgttgcc cgtgctcgta tcctggcgca gcaggcccgc       900
     gccgacgaga ccctcgccct gctgcaacgt ggggccgaca cccaatcgga ggtcgactac       960
     acgcggcact cccaggcgtt gtccgacgag ctgacccggc agctcgacag cgcacacggt      1020
     gacgtggccg cggacgacct ccgggacgcc gagacggcgc gcgagggctg gctggccgcg      1080
     caccgggaca tcgagatcgc cctcgagcgc ggtgactacc cgaccgccgc ggcgatcgcc      1140
     gccgggtccg gctccggtac gtcggcggcg aagttcgcgg tcatggacgc ggccctccgg      1200
     gacgcgatcg accgactacg cgacgacgag gcagccgctg tgaccgacgc ctaccggtcg      1260
     atgtcgtccc tggcgatcgg tagcatgatt attggcgtgt cctgcggatt cgccgtcggc      1320
     gggggtatct ggccgcgact gaacgagtac cactga                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page