(data stored in ACNUC7421 zone)

EMBL: AP011115.PE372

AP011115.PE372       Location/Qualifiers
FT   CDS_pept        complement(384585..384842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48619"
FT                   /db_xref="GOA:C1ARE2"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE2"
FT                   /protein_id="BAH48619.1"
FT                   /translation="MVWAALLVAVLLIEGPPARVVVAGATAVGVLVVQLAGVRPRLTRR
FT                   SDRVLAGEDVPRSHAHYVYIGLEVAKVVALLVTGVLLLGV"
     atggtgtggg cggcgctgct cgtcgccgta ctcctcatcg aggggccgcc tgcccgggtt        60
     gtggtcgcgg gggcgaccgc ggtcggcgtg ctcgtggtcc agttggccgg ggtccggccc       120
     cggttgacgc gtcggtccga ccgcgtcctc gccggcgagg acgtcccgcg ttctcacgcg       180
     cactacgtct acatcggcct ggaagtggcg aaggtcgttg ctctgctcgt gacgggagtt       240
     ctgctactcg gtgtttga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page