(data stored in ACNUC7421 zone)

EMBL: AP011115.PE373

AP011115.PE373       Location/Qualifiers
FT   CDS_pept        385015..385887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48620"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE3"
FT                   /protein_id="BAH48620.1"
FT                   /translation="MSSRGSAAEWASGQVHAVRDDPDARLELSARTYHGPVGNAPRHLP
FT                   FRRAALSFMRWQVGRGVLAALDASPPGSPWWRAVNERLLRDGCEAVARSGGMGGTPSSQ
FT                   AVDLWMLFVADPTARTWYRAHNASIVSAYLDHRGLAESESRPERFFLNVVLLRVLFAHA
FT                   LVAAPRLALGRLAPAGPLLGDPRLSMTGIFLSLSRVLPDRYPLGDDVAAYVAAEHNLGE
FT                   LLDYGLIGPRLQQLYEWSAAELDEPRLLGCIRDGSPTYAWSYTDREVWHPARPAATIRA
FT                   VRRFVPARR"
     gtgagttccc gaggttccgc cgcagagtgg gcgtccggcc aggtccacgc cgtgcgtgac        60
     gatcctgatg cccgcctcga gctgagcgcc cgcacgtatc acggtccggt gggcaacgca       120
     ccgcggcacc tgccgtttcg ccgggcggcg ctgtcgttca tgcgctggca ggtcggccgc       180
     ggtgtgctgg ccgcgctcga cgcgtcgccg cccgggagtc cgtggtggcg ggcagtcaac       240
     gagcgcctgc tgcgcgacgg gtgcgaggcg gtcgcccgga gcggcgggat gggcgggacg       300
     ccgtcatcgc aggcggtcga cctgtggatg ctgttcgttg ccgatccgac cgcacgcacc       360
     tggtaccggg ctcacaatgc gagcattgtc tccgcctacc tcgaccatcg cggcctcgcc       420
     gaatccgaga gccgtcccga gcggttcttt ctcaacgtcg tgctgctccg cgtcctcttc       480
     gcacacgcct tggtcgcagc gccacgtctg gcgctcgggc ggctcgcgcc ggctggcccc       540
     ctactcggcg atccgcgact gtcgatgacg ggcatcttcc tctcgctctc gcgcgtactc       600
     cccgatcgat atccactcgg agacgacgtc gcggcgtacg tcgccgccga gcacaacctc       660
     ggcgagctgc tggactacgg cctgatcgga ccgcgcctgc agcagctgta cgaatggtcg       720
     gccgccgaac tcgacgaacc gcggctgctc ggctgcatcc gcgacggcag ccccacctat       780
     gcctggtcgt acaccgatcg cgaggtgtgg catccggcgc gaccggccgc cacgatccgc       840
     gcggttcggc gcttcgtgcc ggctcgccgg tag                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page