(data stored in ACNUC7421 zone)

EMBL: AP011115.PE377

AP011115.PE377       Location/Qualifiers
FT   CDS_pept        388201..389556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03770"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48624"
FT                   /db_xref="GOA:C1ARE7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE7"
FT                   /protein_id="BAH48624.1"
FT                   /translation="MVVMDTDKELESQIGQWRGYVERRHAISAADTDEMEDHLRDQISD
FT                   LSAAGLETDEAFLVAVKRMGNVDDISREFAREHSDRLWKQLVLIPAAPDGDRTRPTREL
FT                   FVVLGFAVGAALALEAGLATLDEQDLARNLSLFILPFLAGYFAWKRKVTLRLAAALVVP
FT                   FVLAAVLLNVFPFVSNGSTEVIAAIHAPIALWFAVGVAYIGGQWRSDRRRMDFIRFTGE
FT                   WVVYLTLLALGGGVLIGLTVNAFDALGLSVEWVVEDWVLPFGAAGAVIVAAWLVEAKQN
FT                   VVENIAPVLTRVFTPLTTLMLLVLLIAFATTGSVVDVDRNLLILMDLILVVVLGLLLYA
FT                   ISARDPYLPPDLFDRLQFVLVVSALAVDLLMLFAMLTRIAEFGFTPNKVAALGMNLVLL
FT                   VNLTWSAVLILGFLRGRREFGSTENWQTRYLPVFGVWAALMVGVLPPIFDFT"
     atggtcgtga tggataccga caaggaactg gaatcgcaga tcggtcagtg gcgagggtac        60
     gtcgagcgcc gtcacgcgat atccgctgcc gacactgatg agatggaaga ccatctgcgc       120
     gatcagattt cggatctgtc cgcggccggc ctggagaccg acgaggcttt tctcgtcgcg       180
     gtaaaacgga tgggcaacgt ggacgacatc tcccgcgagt tcgcgcggga gcactccgat       240
     cggctgtgga agcaactcgt gctgataccg gccgcgccgg acggcgatcg cactcgtccc       300
     acccgtgaac tgttcgtcgt tctcgggttc gcggtcggcg cagcactcgc cctcgaggca       360
     gggttggcga cactcgacga gcaggacctc gcccgcaacc tcagcctgtt cattcttccc       420
     ttcctcgccg gatacttcgc gtggaaacgg aaggtgacgc ttcgactggc cgcggcgctg       480
     gtggtgccgt tcgtcctggc ggcggtgctg ttgaacgtct tcccgttcgt ctcgaacggc       540
     tccaccgagg tgatcgcggc gatccatgca cccatcgcgt tgtggttcgc cgtcggtgtc       600
     gcgtatatcg gcggccagtg gcggtcggac cggcggcgaa tggacttcat tcgattcacc       660
     ggagagtggg tggtctacct gaccctcctc gccctcggcg gcggcgtgct catcggcctg       720
     acggtcaatg ctttcgacgc cctcggcctg agcgtcgagt gggtcgtcga ggactgggtg       780
     ctgccgttcg gagcggccgg tgcggtcatc gtcgccgcat ggctcgtcga ggcgaaacag       840
     aacgtcgtgg agaacatcgc ccccgtcctc acgcgtgtgt tcacaccact gacgactctc       900
     atgctgctgg tgctgctgat cgcattcgcg acgaccggca gcgtggtcga cgtcgaccgg       960
     aacctgctga tcctgatgga cctcatcctg gtcgtcgtcc tgggcctgct gttgtacgcg      1020
     atttccgccc gcgaccccta cctgccgccc gaccttttcg accgcctcca attcgtcctc      1080
     gtcgtcagcg ccctcgcggt cgacctgctg atgctgttcg ccatgctcac tcgaatcgcg      1140
     gaattcggct tcaccccgaa caaggtggcc gcactcggaa tgaacctggt cctgctcgtc      1200
     aacctgacct ggtcggcggt tctcatcctc gggttcctcc ggggccgccg cgaattcggg      1260
     tccaccgaaa attggcagac ccgttacctc cccgtcttcg gtgtgtgggc ggcgttgatg      1320
     gtcggtgtac ttccgccgat attcgacttc acctga                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page