(data stored in ACNUC7421 zone)

EMBL: AP011115.PE379

AP011115.PE379       Location/Qualifiers
FT   CDS_pept        complement(390663..393500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03790"
FT                   /product="rod shape-determining protein/penicillin-binding
FT                   protein"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48626"
FT                   /db_xref="GOA:C1ARE9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE9"
FT                   /protein_id="BAH48626.1"
FT                   /translation="MQDGKHESDPWIVGAAIVLVVLGLLNLTATGMTGHAVRHLLFAAA
FT                   GLAIMWVVSRLRVSDLRTFGWAVFGVATLLLAAVPLAGVATKGAQRWLNFGVFTVQPSE
FT                   LAKLALILVPASMLAGGFTLARFLATLGIAAVPVTLVAVQPDLSTAVVLVATAGFMLIL
FT                   ARVPLLPLVPLFVVGIASLPLAVLFLRPYQLERVHVFLSSNADPAGAGWAELQANIAIG
FT                   SGGLWGLARDPLYDVRAQFLPESEHDLAFASLVYGWGLIAGLAVVVATSVIVWRAALAA
FT                   RTARTREAALVAAGIGGLFGIHALVSIGQSLSLLPHTGMPIPLFSYGGTAAIVGFAAIG
FT                   LVLAVRRDGVARPLWAPDPGRRRRPRGMSAGTMTMIAALVAMSVFAWQVQHDRGAEYRA
FT                   MSDAQMMRCIRLPAERGLIVDRNGVPLVVNVAEYAVAVVARMFEDSDDDARNRLAALLV
FT                   KSPNELSDLIDAGGEGETQVAVGRVAPDQARRIVDARIPGVLVVPSGRRQYPYGAVLAS
FT                   ILGHVGVADADDMERWPHLALGSRVGKAGLEKQYDALLRGSDGKQCMYVDPSGNPVATG
FT                   ERVDPVRGHDLRLHLDIGVQTLATDALTEAMRTSKGDLGAAVVMDARTGAVLALASVPG
FT                   ADNNVYGPPADLVALTAQSQTPGPSPLVNHATQTAVPPGSTFKIVVASADMQYPVLSPD
FT                   AVIETGAAYTYGGHTFRNWQPMGPNNLLGAIQWSDNVYFYKLGELLGPEKMADVASQLG
FT                   AGRRSGIDLPGESEGFLGTPENVGSIGATWYPGSTLLMGIGQGTVSATPIQVARWTSGI
FT                   ATGAMVTPQLAAAYGPELISIPTAAPQRLAFADRLDPVRAGMRASAAAGTAGQLANLPV
FT                   PAGAKTGTAEDPSAPGEGLNAWFSAVAPFDAPEIVVSVLVRGGGFGSATSGPVVKKILE
FT                   HYFPRPPAPAPAPGR"
     atgcaggacg gcaagcacga atccgatccg tggatcgtcg gggcggcgat cgtcctcgtc        60
     gtgctcggtc tcctgaatct gacggcgact gggatgacgg ggcacgccgt tcgccatctg       120
     ctcttcgcgg cggccgggct cgcgatcatg tgggtggtgt cccgcctgcg ggtgagtgac       180
     ctccggacct tcggctgggc ggtgttcggg gtggcgacgc tgttgctcgc ggccgttccc       240
     ctcgcggggg tcgcgacgaa gggcgcgcag cgctggctga acttcggggt gttcaccgtt       300
     cagccgtccg agttggccaa actcgcgctg atcctggtgc ccgcgagcat gctcgcgggt       360
     gggttcaccc tcgcgcgttt tctcgcgacc ctggggattg cagcggtgcc ggtgacgctc       420
     gtcgcggtcc aacccgacct gtcgacggcc gtcgtgctcg tcgcgacggc gggattcatg       480
     ctcatcctcg cgcgggttcc gctgctcccg ctggtcccgt tgttcgtggt ggggatcgcg       540
     tcgctgccgc tcgcggtgtt gttcctccgg ccgtatcagc tcgaacgggt gcacgtgttc       600
     ctgtcgagca acgccgaccc ggcaggcgcg gggtgggccg agttgcaggc gaacatcgcg       660
     atcggcagcg gcggcctgtg gggtttggcg cgtgacccgc tgtacgacgt gcgggcgcag       720
     tttcttcccg aatcggagca tgatctggcg tttgccagcc tggtgtacgg gtggggtctg       780
     atcgccggcc tggcggtggt ggtggcgacg tcggtgatcg tgtggcgggc cgcactcgct       840
     gcgcgcacgg cacgaacccg ggaggcggca ctcgtcgcgg ccggaatagg tgggctgttc       900
     ggcatccacg cgctggtgtc gatcggacag agtctgtcgc tgctgcccca caccgggatg       960
     ccgattcccc tcttcagcta cggcgggacg gccgcgatcg tcggattcgc cgccatcggt      1020
     ctggtgctcg cggtgcgccg agacggcgtc gcgcggccgc tgtgggcccc cgacccgggg      1080
     cggcggcgtc gaccacgcgg aatgtcggcg gggacgatga cgatgatcgc cgcgctcgtc      1140
     gcgatgtcgg tgttcgcctg gcaggtgcag cacgaccggg gcgcggagta tcgggcgatg      1200
     agcgatgcgc agatgatgcg gtgcatccgc ctgcctgccg aacgcggact gatcgtcgac      1260
     cgcaacggtg tccccctcgt ggtgaacgtg gccgagtacg ccgttgccgt ggtcgcccgg      1320
     atgttcgagg acagcgacga cgacgcccgc aaccggctcg ccgcgctgct cgtgaagtca      1380
     cccaacgagc tgtcggacct gatcgacgcc ggcggcgagg gcgaaaccca ggtggccgtg      1440
     ggcagggtcg cgcccgacca ggcgcggcgc atcgtggacg cgcggattcc cggtgtcctc      1500
     gtggtgccgt ccggtcgtag gcagtacccg tacggcgccg tactcgcgtc catcctcggt      1560
     cacgtcggag tcgccgacgc cgacgacatg gaacggtggc cacaccttgc actcgggtca      1620
     cgcgtcggca aggcgggact cgagaagcaa tacgacgctc tgctccgcgg cagtgacggc      1680
     aaacagtgca tgtacgtcga tccgtccggc aatccggtgg ccaccggcga gcgtgtcgac      1740
     ccggtacggg gccacgatct gcgcctgcac ctcgacatcg gcgtgcagac cctggccacc      1800
     gacgcactca cggaagcgat gcgaaccagc aagggcgacc tcggcgccgc cgtcgtgatg      1860
     gacgcgcgaa ccggagcagt actggcgctc gcgagcgtcc cgggcgccga caacaatgtc      1920
     tacggacccc cggccgatct cgtcgccctc acggcgcaga gccagacccc gggtccgagt      1980
     ccgttggtca accacgccac ccagaccgcg gtgccgcccg gttcgacatt caagatcgtg      2040
     gtcgcgtcgg cggacatgca gtacccggtg ctctcgccgg acgcggtcat cgagaccggc      2100
     gcggcgtaca cgtacggcgg ccacaccttc cgcaactggc agccgatggg cccgaacaat      2160
     ctgctcgggg cgatccagtg gtccgacaac gtctacttct acaagctcgg tgagcttctg      2220
     gggccggaga agatggccga cgtcgcgagc caactcggcg cgggacggcg gtccgggatc      2280
     gacctgcccg gtgagtcgga gggatttctc ggcaccccgg agaacgtcgg aagcatcggg      2340
     gccacgtggt atcccgggtc gacgctgttg atgggtatcg ggcagggcac ggtcagcgcg      2400
     accccgatcc aggtggcgcg ctggacgtcg gggatcgcca ccggcgcgat ggtgacacct      2460
     cagctggccg cggcatacgg gccggaactg atctccatcc ccaccgcggc accgcagcgg      2520
     ctcgcgttcg cggaccgtct cgatcccgtc cgggcaggga tgcgcgcctc cgccgccgcc      2580
     gggaccgccg ggcaactcgc gaacctgccg gtaccggcag gcgcgaagac cggaaccgcg      2640
     gaggatccgt cggcgccggg ggaggggctc aacgcctggt tctccgcggt ggcgccgttc      2700
     gacgcccccg aaatcgtggt gtcggtgctg gtccgtggag gtggtttcgg gtcggcgact      2760
     tccggccccg tggtcaagaa gatcctcgag cactacttcc cgcgaccacc ggcaccggcg      2820
     ccggcgccgg ggcggtga                                                    2838
//

If you have problems or comments...

PBIL Back to PBIL home page