(data stored in ACNUC7421 zone)

EMBL: AP011115.PE384

AP011115.PE384       Location/Qualifiers
FT   CDS_pept        397978..399447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03840"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48631"
FT                   /db_xref="GOA:C1ARF4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF4"
FT                   /protein_id="BAH48631.1"
FT                   /translation="MTTERVMGSKAADQECQDCGYEPELKRTLGSFQVFAVSFAFISVA
FT                   VGIFGTYDDVLRDAGPVGIWLWVVVALGQILVALVIAQFAARIPLSGSSYQWASRLANP
FT                   KVGWLFGWLTFCYLALGVVTVDNAMASSALMPLFGMQPDEGTARVITLVVVLVQAVLVV
FT                   FSTRLVGLITSGAVGLELVIVVVLAIGLFVAVPITGEGSVGNLTSRGVAEGAPNYFAVG
FT                   GGLMAATIMGLATLVGFDSAANMAEEAKDPFRSVPRAIVGSVVAAAVLGLVFLIALTIA
FT                   IEDVPRISDSDTPVAAILRDQLGPVMERTLLVAIAFAFFGAGMVTLATCSRMVFAMSRD
FT                   ARFPAHRLMRRVNPRTQTPIPATILIVVVGVVLMAALPGGALLELLTVGTVISAVLYGG
FT                   IVVLYLAVRTRLDRKEGAFDLGRFELPVAICALVWSAFVVFVIVSPSTALTSILIAVGL
FT                   LLAGGVYFTYLLIFKRDVLDTEPGDADVFAH"
     atgacgacag aacgcgtgat gggatctaaa gctgccgatc aagaatgtca ggactgcggc        60
     tacgaaccgg agctgaagcg aactctgggc tcctttcagg tgttcgccgt ctcgttcgcg       120
     ttcatctcgg tggcagtcgg gatcttcggc acctacgacg acgtacttcg cgacgcgggg       180
     ccggtgggga tctggctctg ggtcgtcgtg gctctgggac agatcctggt ggcgctggtg       240
     atcgcccaat tcgcggctcg gatcccactc agcggctcct cctaccaatg ggcctcacgg       300
     ctggccaacc cgaaagtcgg ctggttgttc ggttggctga ccttctgcta cctggcgctc       360
     ggcgtggtga cggtcgacaa tgcgatggcg agttccgccc tcatgccgct gttcggcatg       420
     cagcccgacg agggcacggc ccgcgtgatc acgctcgtcg tggtgcttgt ccaggcagtg       480
     ctcgtcgtgt tctccacgcg cctcgtcggc ttgatcacgt cgggcgcggt ggggctcgaa       540
     ctggtgatcg tcgtggtgct cgcgatcggg ctcttcgtcg ccgtgccgat cacaggcgag       600
     ggctcggtcg gcaacctcac ctcccgcggt gtcgccgagg gcgcccccaa ttatttcgcc       660
     gtgggcggcg gattgatggc ggcgacgatc atggggctcg ccacactcgt cggcttcgac       720
     tccgcggcga acatggctga ggaggccaag gatccgtttc gcagcgtccc gcgcgcgatc       780
     gtggggtcgg tggtggcggc ggcggtgctg ggactggtgt ttctgatcgc gctcaccatc       840
     gcgatcgaag atgttccccg gatcagcgac agtgacacgc cggtggcggc gatcctgcgc       900
     gatcagctgg gtccggtgat ggagcgaacc cttctggtcg caatcgcgtt cgccttcttc       960
     ggcgcgggga tggtgacctt ggcgacctgc tcgcgcatgg tgttcgcgat gtcgcgcgac      1020
     gcacgcttcc ctgctcaccg gctgatgcgc cgggtcaacc cgcgcacgca gacacccatt      1080
     ccggcgacca tcttgatcgt cgtcgtggga gtcgtcctga tggccgcact gcccggcggt      1140
     gcactgctgg agttgctcac ggtgggaacg gtcatctcgg cggtcctcta cggcgggata      1200
     gtcgtcctct atcttgcagt ccgcacacgg ttggatcgga aggaaggcgc gttcgacctc      1260
     gggcgcttcg agctaccggt cgcgatctgc gcactggtgt ggtcggcctt cgtggtgttc      1320
     gtgatcgtgt cgccctcaac tgcgttgacc tcgatattga ttgcggtcgg attgctcctc      1380
     gcgggcgggg tgtacttcac ctatctgttg atattcaaac gcgacgtatt ggacaccgag      1440
     cccggagacg ccgatgtctt cgcgcactga                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page