(data stored in ACNUC7421 zone)

EMBL: AP011115.PE386

AP011115.PE386       Location/Qualifiers
FT   CDS_pept        400884..401225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48633"
FT                   /db_xref="GOA:C1ARF6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF6"
FT                   /protein_id="BAH48633.1"
FT                   /translation="MDSVEHDLTDEQWSALTEAWGGCAYCGATDKPLQRDCVQALSRGG
FT                   RYTLDNIAPACGSCNASKCNDEVTGWLRRKRLDERAFLLRHIEIKSALARRFPAEPDPA
FT                   IEMPDTAAP"
     atggacagtg tcgagcacga cctcaccgac gagcagtgga gtgccctcac cgaggcgtgg        60
     ggcggctgcg cgtattgtgg tgcgaccgac aagccgctgc aacgcgactg cgtacaggca       120
     ctgtcccgcg gcgggcggta caccctcgac aacatcgccc cggcctgcgg ctcctgcaac       180
     gccagcaaat gcaacgacga ggtcaccggc tggctgcggc gcaagcggct cgacgagcgt       240
     gccttcctgc tgcgtcacat cgaaatcaag agtgcactcg cacggcgatt ccccgcggaa       300
     ccggaccccg cgatcgagat gccggatacc gccgccccgt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page