(data stored in ACNUC7421 zone)

EMBL: AP011115.PE388

AP011115.PE388       Location/Qualifiers
FT   CDS_pept        complement(401903..403168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48635"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF8"
FT                   /protein_id="BAH48635.1"
FT                   /translation="MSVTGVGPVLDVGRADGAAAALRTTTAVRERAQLLVRRAREGGSR
FT                   WFDVDDGALQTAAGEVVDVTHARYPDLKIPFHSRWRHFEAGGVDRKAELDARLAALDAP
FT                   GRARAMIDLAVVSVLLDAGAGPDWQYREEASGQRFARSEGLGVASWHAFLGGLFSSDGA
FT                   QPLRVDAAGLRGLDADRLAQAFQVGPSNPLVGLEGRVLLLRRLGEALAVQPDVFGLHGR
FT                   PGGLFDLLVAPQVPGAATVAAHDILSQLLTSLSGIWPAGNAIGTEPLGDCWPHDSVDGP
FT                   GLTRGWVPFHKLSQWLTYSLLEPFQWAGVQVVGLDALTGLPEYRNGGLLLDTGVLRLRD
FT                   PGWAARSWAAGDELIVEWRALTVALLDELAPLVRARLDVDAREMPLACVLEGGTWAAGR
FT                   ALAQRTRGGLPPLSVVSDGTVF"
     gtgagcgtca ccggcgtcgg tcccgtcctg gacgtcgggc gggccgacgg tgcggcggcg        60
     gccctgcgca ccacgaccgc cgtgcgggaa cgcgcgcaac tgctggtgcg tcgcgcgcgc       120
     gagggcggct cccgctggtt cgacgtggac gacggcgcgc tgcagacggc cgcgggcgag       180
     gtcgtggacg tcacgcacgc ccgctacccg gacctgaaga tcccgttcca cagccggtgg       240
     cgccatttcg aggccggcgg agtggatcga aaggccgagc tggatgcacg gttggccgcg       300
     ctggacgcgc cgggccgcgc ccgcgccatg atcgacctcg ccgtcgtcag cgtgctgctc       360
     gatgccggcg ccggtcccga ctggcagtac cgcgaggagg cgagcgggca gcgcttcgcc       420
     cgttccgagg gcctgggtgt cgcgagttgg cacgccttcc tcggcggact gttctcgagc       480
     gacggcgcgc agccgctgcg ggtcgacgcg gcgggactgc gtggcctgga cgcggaccgg       540
     ctggcccagg cgttccaggt gggtccctcg aatccgttgg tgggactcga gggccgggtg       600
     ctgcttttgc gccggctggg tgaggcgctc gccgtgcaac cggacgtgtt cggtctgcac       660
     ggccggccgg gcggtctgtt cgacctgctc gtcgcgccgc aggtaccggg cgcggcgacg       720
     gtggcggccc acgacatcct gtcgcagctg ctgacgtcgc tgtcgggcat ctggccggcg       780
     ggcaacgcca tcggcaccga accgctgggc gactgctggc ctcacgattc agtggacggt       840
     ccgggtctga cccggggctg ggtgccgttc cacaaactgt cgcagtggct gacctattcg       900
     ttgctcgagc ccttccagtg ggccggtgtg caggtggtgg ggctggacgc gttgacggga       960
     ctgcccgagt accgcaacgg cggcctgctg ctggacaccg gcgtgctgcg cctgcgcgac      1020
     cccggctggg ctgcgcgcag ctgggctgcg ggcgacgaac tcatcgtcga atggcgggcg      1080
     ttgacggtgg cgctgttgga cgaactggcc ccgctggtgc gcgcacggct ggatgtggat      1140
     gcccgggaga tgccgctggc ctgcgtcttg gaaggcggca cctgggcggc gggccgtgcg      1200
     ctggcacagc gcacccgtgg tgggctgcca ccgctctccg tcgtcagcga cggcacggtc      1260
     ttctag                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page