(data stored in ACNUC7421 zone)

EMBL: AP011115.PE390

AP011115.PE390       Location/Qualifiers
FT   CDS_pept        404636..405997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48637"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG0"
FT                   /protein_id="BAH48637.1"
FT                   /translation="MDLRTQDEADDVFTRGDALQASVPSRAHDHAATGAGRPDVLNFVE
FT                   ADNEGRLTHLVPLRIGRMIASPFAFFRGAAGLMAADLAASPVTGLTAQLCGDAHAANFG
FT                   LYGTPDGQIVMDINDFDETLPGPWEWDLKRLAASLVLAGREGGVSESGCVEAAEDAVKS
FT                   YRRTMRDLAELPFLQSWNALPDKSVLARAKADALLDDFDKAAQKARRNTSEKVAAKWTA
FT                   HFENHETGIRRRRFVDDPPILTHVDRATADAVTDGLERYVDSLRESRRNLITRFVVSDV
FT                   AFRIVGTGSVGLRSYIALLHGNRDEVLVLQLKQARPSALAAYLPVDEPKHEGKRIVHGA
FT                   RLVQAESDILLGWTTIDGLPYIVRQFRNLKGDIDPTGLEQDHLDDYGRLAGALLARAHT
FT                   RSLDPRALAGYFAGDTELDEAIGRYAVRYADQTEADHAELVAAVKSGRMAAEPA"
     gtggatctgc gaacccagga cgaggcggac gacgtattca cgcgcggcga cgcgttgcag        60
     gcaagcgtgc cgtcccgtgc acacgatcat gccgcgaccg gcgccggccg gccggatgtg       120
     ctgaacttcg tcgaggccga caacgagggc aggttgacgc atctggtccc cctgcggatc       180
     ggccggatga tcgcctcgcc gttcgccttc ttccgcggcg ccgccggcct gatggcggcc       240
     gacctcgccg cctctccggt caccggactg acggcgcagc tgtgcggtga cgcgcatgcg       300
     gcgaacttcg gcctgtacgg gacgccggac ggtcaaatcg tcatggacat caatgatttc       360
     gacgagaccc tccccggtcc gtgggaatgg gatctcaaac gtctcgcggc cagcctggtc       420
     ctcgccggac gcgagggcgg agtgtccgag agcgggtgtg tcgaggccgc cgaagacgcc       480
     gtcaaatcgt atcggcgcac catgcgcgat ctcgccgaac ttccgttcct ccagtcctgg       540
     aatgcgctgc cggacaagtc ggtgctcgcg cgggcaaagg ccgacgctct gctcgacgac       600
     ttcgacaagg ccgcgcagaa ggcgcgacgc aacaccagcg agaaggtggc ggcgaaatgg       660
     accgcccatt tcgaaaatca cgagaccggg atacgccggc gacggttcgt cgacgatccg       720
     ccgatcctca cgcacgtgga tcgcgcgacc gccgatgcgg tgaccgacgg gttggaacgc       780
     tatgtcgact cacttcggga gtcgcgacgg aacctgatca cccgattcgt cgtgtccgac       840
     gtcgccttcc ggatcgtcgg gaccggcagc gtggggctcc gcagctatat cgctctgctg       900
     cacggcaatc gggacgaggt gctcgtcctt caactgaaac aggcccggcc gtccgcactg       960
     gcggcgtacc tgccggtcga cgaaccgaag cacgagggca agcggatcgt gcacggtgcc      1020
     cggttggtgc aagcggaatc ggacatcctt ctgggctgga cgacgatcga cggcctcccc      1080
     tacatcgtgc gtcagttccg gaacctcaaa ggcgacatcg atccgaccgg tctggagcag      1140
     gatcatctcg atgattacgg ccgcctggcc ggcgccctgc tcgcccgcgc acacacccgc      1200
     tcactcgacc cgcgggcgct cgccggatac ttcgcgggcg acaccgaact ggacgaggcg      1260
     atcggccggt atgccgtccg ctacgccgat cagaccgaag ccgaccacgc agaactggtg      1320
     gccgcggtga aatcggggcg gatggccgcc gaaccggcct ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page