(data stored in ACNUC7421 zone)

EMBL: AP011115.PE391

AP011115.PE391       Location/Qualifiers
FT   CDS_pept        complement(406017..406367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48638"
FT                   /db_xref="GOA:C1ARG1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG1"
FT                   /protein_id="BAH48638.1"
FT                   /translation="MESLALASAVVEQLAPVATKSRRTRTGRTVQDVVPAPSIHLRVAV
FT                   TWVSIFPLVTLGMTVMTLSGPITATWPTWLRALSLTGVVVPTAVYFVVPRILAVALRWL
FT                   SWRRRRSAATPG"
     atggaatctc tcgctctggc atccgcagtg gtggagcagc tcgccccggt ggcaacgaag        60
     agtcgccgca cgcggacggg ccggactgtc caggacgtcg tgccggcgcc gtccattcac       120
     ctgcgggttg ccgtcacctg ggtctcgatc ttcccgctcg tcacgctggg catgaccgtc       180
     atgacgctgt cgggcccgat cactgccacc tggccgacct ggcttcgcgc gctgtcgctg       240
     accggtgtcg tcgtccccac ggcggtgtac ttcgtcgtgc cgcgaatcct cgccgtggcc       300
     ctccggtggt tgagttggcg gcgacggcgc tccgccgcca caccgggctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page