(data stored in ACNUC7421 zone)

EMBL: AP011115.PE394

AP011115.PE394       Location/Qualifiers
FT   CDS_pept        408297..408824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48641"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG4"
FT                   /protein_id="BAH48641.1"
FT                   /translation="MRTASWVSAATAVLLGATAAAAWRKANLADQARHEAEAALEAALG
FT                   QLEAMTRIAEAAQQALPRPLEVEFDVQRIRGPVDRFRLHNVGTGIATDVRFVVDPAEEQ
FT                   NRRVPTPQWLHEGAVTLLPKEWADFSASALSPVAGSWRIVFPAFVTVIHDGAGTPQRVD
FT                   LPTTVTEDGVIG"
     atgagaaccg catcgtgggt cagcgcggcg actgcggtgt tgctcggcgc caccgctgcc        60
     gcagcctggc ggaaagcgaa tcttgccgat caggccaggc acgaagcgga ggccgcgctg       120
     gaggcggcgc tcgggcaact cgaagcgatg accaggatcg ccgaagccgc gcaacaggcg       180
     ctcccgcggc cgctggaagt cgagttcgac gtccagcgca tccgtggacc cgtcgaccgg       240
     ttccggctac acaatgtcgg aaccggtatc gccaccgacg tgcgattcgt cgtcgatccc       300
     gccgaggagc agaaccggcg ggtcccgacg ccgcagtggc tgcacgaagg agcggtgacg       360
     ttgctaccga aggagtgggc cgatttctcc gcgagcgcac tgtctcccgt cgccggctcg       420
     tggcgaatcg tgtttccggc cttcgtcacc gtgatccacg acggggccgg gactccgcaa       480
     cgagtagacc tgccgacgac cgtcaccgag gacggcgtga tcggctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page