(data stored in ACNUC7421 zone)

EMBL: AP011115.PE396

AP011115.PE396       Location/Qualifiers
FT   CDS_pept        409487..409969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48643"
FT                   /db_xref="GOA:C1ARG6"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG6"
FT                   /protein_id="BAH48643.1"
FT                   /translation="MQYADNIRISDSERDQVVAELGRHLTAGRLTIGEFDQRAAEVYRS
FT                   TTRQQAHQVLRDLPSAAPTVAAASVTTPPTRPARRRIPGHQKIEWLAWAVAGGINIAIW
FT                   GIVSLATGAMIYAWPVWVIGPWGLVLLGRTVLGRESGCSKFTDALRDDRMRAVASR"
     atgcagtacg cggacaacat ccggatatcc gattccgaac gcgaccaggt cgtcgccgaa        60
     ctcgggcggc acctcaccgc ggggcggctg accatcgggg agttcgacca gcgggcggca       120
     gaggtctatc gatcgaccac ccggcaacag gcccatcagg tgttgcgtga cctaccgtcc       180
     gcagccccca ctgttgccgc tgcatcggtc acgacgccac ccacccgtcc ggcgcgtcgc       240
     agaattcccg gccaccagaa gatcgaatgg ctcgcctggg ccgtcgcggg cggaatcaac       300
     atcgcgatct ggggcatcgt ctcactcgct accggcgcga tgatctacgc ctggccggtg       360
     tgggtgatag gcccgtgggg gttggtgctg ctgggcagga ccgtgctcgg ccgcgagagc       420
     gggtgcagca aattcacgga cgctctacgc gacgaccgga tgagagccgt cgcgagtcgc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page