(data stored in ACNUC7421 zone)

EMBL: AP011115.PE397

AP011115.PE397       Location/Qualifiers
FT   CDS_pept        410014..410415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48644"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG7"
FT                   /protein_id="BAH48644.1"
FT                   /translation="MKRVVQSRIVSSVAPRSLSHPCTPPGRASQRARTPSMASGTRPRR
FT                   SRSLGCARPGSGAKQHRSGRGGRHLQDVHEPVPRIEPVAYGYAAQNRPGTPESAEARKG
FT                   DQRRRDQARHSLQPTAWGPARTRNRYTPR"
     gtgaagcgcg tggtccagag tcggatcgtc tcgtcggtgg caccgcgctc tctcagccac        60
     ccgtgcacgc cgccgggacg ggcatcccag agggcgagga caccttcgat ggcctcgggg       120
     acgagaccgc gcagatcacg gtcgttggga tgcgcccgac cgggctcggg ggcgaagcag       180
     caccggtccg ggcgcggtgg ccgccacctg caggacgtcc acgagccggt cccccgcatt       240
     gagccggtcg cctacggcta cgccgcgcag aaccgaccgg gtacgcccga atcggccgaa       300
     gcgcgtaagg gcgaccagcg acgccgtgac caggcaagac attccctgca gccgaccgcg       360
     tgggggcctg cgcggaccag aaataggtat accccccggt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page