(data stored in ACNUC7421 zone)

EMBL: AP011115.PE4

AP011115.PE4         Location/Qualifiers
FT   CDS_pept        2534..3160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48251"
FT                   /db_xref="GOA:C1AS02"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS02"
FT                   /protein_id="BAH48251.1"
FT                   /translation="MDLIRPLQTVTPTLDGDVLSALAAASEATFTTGQLHRVLHHHSEE
FT                   GIRKVLQRLSKQGTVLSSRVGNAFVYQLNREHLAFPHVVGLADLSGEFLRRLEARLAGW
FT                   EIPPVYAAVFGSAARGTMTIDSDIDIFLVRPDDVAEEEWDEQVAELMAEVTRWTGNDAR
FT                   DLQFAQSEIAGRGTDEPVLRDVVKEGLTVAGSRAGFTRLLRRGNR"
     atggatctga ttcggccgct gcagacagtg acgcccacgc ttgacggtga tgtgctctct        60
     gcgctggcgg ccgcatctga ggcgacattc acgacgggcc agttgcaccg ggtgctgcac       120
     caccattcgg aggaggggat acggaaggtg ttgcaacgct tgagcaagca gggcacggtg       180
     ctgtcttcga gggtgggaaa cgcgttcgtg taccagctca atcgtgagca cctggccttc       240
     cctcatgtcg tgggtcttgc cgacttgtct ggcgagttcc tgcgcaggtt ggaggcgcgg       300
     ttggccggct gggagattcc cccggtgtat gccgctgtgt tcggttcggc tgcgcgcgga       360
     acgatgacga tcgacagtga catcgacatc ttcctggtcc ggccggacga cgtcgcagaa       420
     gaggagtggg atgaacaggt ggcggagctg atggccgaag tgaccagatg gaccggcaac       480
     gatgcgcggg atctgcagtt cgcgcagagc gagatcgccg gccgcggcac ggacgagccg       540
     gtcctgcggg atgtggtgaa ggaggggctg acggtggccg gttcacgggc cggtttcacc       600
     cggttgctgc gtcggggtaa tcggtaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page