(data stored in ACNUC7421 zone)

EMBL: AP011115.PE40

AP011115.PE40        Location/Qualifiers
FT   CDS_pept        complement(32665..34821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00400"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48287"
FT                   /db_xref="GOA:C1AS38"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS38"
FT                   /protein_id="BAH48287.1"
FT                   /translation="MTRSTALGGDAPPADTITAGGVLGRMGAAMAGHAKWVFGIWLILL
FT                   VVLGAAAPSVFSSLAGAGWQANGSESVQVRELAQQHFGGNSSAAVQVVVHSDTQTIDGP
FT                   QMQQTLGEVGAVFAGDPRFGAVIAPQPGMSISPDGHTGILIAGANASTDEMVKAVDDHK
FT                   AALTALTGDGIEVYPTGASALWSDFNKANHDAMIQAELFSWPVTLAIMVLAFGSLVAAG
FT                   LPLLLTLAGLVASAGGLVLLNEITPISVWAMNFAMMFALALGIDYALFIVARFRDALTN
FT                   GGGPRAAVAETMDTAGKAVVLSGITVLVSLSAVLLVPAPAVRTMAVGIMLAVFFVLVAS
FT                   MTLLPAVLGALGGRVNAGSLPYAKRQQHRSPRFAAWGELLHRHPWPFAIGSLLVLIALA
FT                   APVLGLKVAMPSIEVVPTDAPVRQGYELVQAQMGEGAPGMLQIIGPAGEGTDAAAAAAA
FT                   TDGIAMVTPPQPAPDGSDYVMLQAMPTVDPSDGQMGTIVDALRAGLPDGAVVGGAPAEN
FT                   LDLQQALNDYLPLIVGIILILGFVLLLVALQAPLIAVLGTVVSLLSTAAAFGVAKLIFQ
FT                   DGHGASLLGFTPQGFLDGWGPVFFFAMIFAIAMDYTVFLLATAKEHYERSGDPKVAHVD
FT                   GLAHSGRVIFAAAAVMVAVFFTFALADPLPPKEMGIILGVAVLLDAVLIRLVLLPVLLR
FT                   LTGHAAWWSPAWLRKVLPNISFSH"
     atgacccgca gtacggcatt gggcggcgac gccccgcccg ccgacacgat caccgccggt        60
     ggtgtcctcg gccggatggg cgcggccatg gccgggcacg cgaaatgggt gttcggcatc       120
     tggttgatcc tgctggtcgt gctcggcgcc gcggcgccgt cggtgttcag ctccctggcc       180
     ggcgccgggt ggcaggccaa cggctccgaa tcggtgcagg tccgcgaact cgcgcagcag       240
     cacttcggcg gcaactcctc cgccgccgtg caggtggtgg tgcactcgga cacccaaacc       300
     atcgacggcc cacagatgca acagacgctc ggcgaggtcg gggccgtctt cgcgggcgac       360
     ccccggttcg gcgcggtgat cgcaccgcag ccggggatgt cgatcagccc ggacgggcac       420
     accggcatcc tgatcgccgg cgcgaacgcg agcaccgacg agatggtcaa ggccgtcgac       480
     gaccacaaag ccgcgctgac cgcgctgacc ggggacggga tcgaggtgta cccgaccggg       540
     gcgtccgcgc tgtggagcga tttcaacaag gccaaccacg acgcgatgat tcaggccgaa       600
     ttgttctcct ggccggtgac gttggcgatc atggtgctcg cgttcggctc gctggtcgcc       660
     gctggactgc ccctgctgct gaccctggcc gggctcgtcg cttcggccgg tgggctggtg       720
     ttgctcaacg agatcacccc gatctcggtg tgggcgatga acttcgcgat gatgttcgcc       780
     ctcgccctcg gtatcgacta tgcactgttc atcgtcgccc ggttccggga cgcactgacg       840
     aacggcggtg gcccgcgagc ggcggtggcc gaaacgatgg acaccgcggg taaggccgtg       900
     gtgctgtccg gaatcacggt gctggtcagc ttgtctgcgg tgctcctggt tcccgcgccg       960
     gcggtgcgga cgatggcggt cgggatcatg ctggcggtgt tcttcgtgct ggtggcgtcg      1020
     atgacgctgc tgcccgcggt gctgggcgca ctcggcggcc gagtcaacgc cgggtccctg      1080
     ccctacgcca agcggcaaca gcaccgttcg ccgcggttcg ccgcctgggg tgagctgctg      1140
     caccgacacc cgtggccgtt cgcgatcggt tccctgctgg tgctgatcgc cctggcggcc      1200
     ccggtgctcg ggctgaaggt ggcgatgccc tcgatcgagg tcgtccccac cgatgccccg      1260
     gtccgccagg gctacgaact cgtccaggcc cagatgggtg agggcgcacc ggggatgctg      1320
     cagatcatcg gccccgccgg cgagggcacc gatgccgccg cggcggccgc ggcgacggac      1380
     ggcatcgcca tggtcacccc gccgcagcct gcacccgatg gcagcgacta tgtgatgctc      1440
     caagccatgc cgaccgtcga cccttccgac gggcagatgg gcacgattgt cgacgccctg      1500
     cgcgccggcc tgcccgacgg cgcggtggtc ggcggggctc cggcggagaa cctggatctg      1560
     cagcaggcgc tgaacgacta ccttccgctg atcgtcggca tcatcctgat tctggggttc      1620
     gtgctgttgc tggtggcgtt gcaggccccg ttgatcgcgg tcctcggcac ggtggtcagc      1680
     ctgctctcga ccgccgccgc gttcggggtc gcgaagctga tcttccagga cggtcacggt      1740
     gcgagcctgc tcggtttcac cccgcagggc ttcctggacg ggtgggggcc ggtgttcttc      1800
     ttcgcgatga tcttcgcgat cgccatggac tacaccgtgt tcctgctggc cacggcgaag      1860
     gagcactatg aacggtcggg ggatccgaag gtcgcgcacg tcgacggtct ggcgcattcg      1920
     ggtcgggtga tcttcgctgc ggccgcggtg atggtggcgg tgttcttcac cttcgccctc      1980
     gcggatccgt tgccgccgaa ggagatgggc atcatcctcg gtgtcgcggt gctgctcgat      2040
     gcggtgctga tccggttggt gctgctgccg gtgctgttgc ggttgaccgg gcacgccgcg      2100
     tggtggtcac cggcctggct gcgcaaggtc ctgccgaaca tcagcttctc gcactaa         2157
//

If you have problems or comments...

PBIL Back to PBIL home page