(data stored in ACNUC7421 zone)

EMBL: AP011115.PE400

AP011115.PE400       Location/Qualifiers
FT   CDS_pept        411153..411407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48647"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH0"
FT                   /protein_id="BAH48647.1"
FT                   /translation="MNAPAMQLLPPRDGLADYRDAVDALRALETHGSLRADPRTALLFD
FT                   SLTDDLIEAAQTNEAGDTMSQREVFAMIDFAISRPRPSL"
     atgaacgcgc cagcgatgca gttgctcccg ccgcgtgacg gtctcgccga ttaccgcgac        60
     gcggtcgacg cgctgcgtgc cctcgaaacg cacggcagcc ttcgggccga tccccgcacg       120
     gcactgctgt tcgacagcct caccgacgac ctcatcgagg ccgctcagac gaacgaggcc       180
     ggcgacacga tgtcccagcg cgaagtcttc gccatgatcg atttcgcgat atcgcgcccg       240
     cgcccctcgc tgtga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page