(data stored in ACNUC7421 zone)

EMBL: AP011115.PE401

AP011115.PE401       Location/Qualifiers
FT   CDS_pept        411582..412307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04010"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48648"
FT                   /db_xref="GOA:C1ARH1"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH1"
FT                   /protein_id="BAH48648.1"
FT                   /translation="MTNDRSESPQSRPKPGGTRRRLPWLLAAAAVAVVGAVAIGAYVLT
FT                   AGSDDARKAHDFAPSADNPDPSLGIEGIVTVDYPPADHVQAPQRVAYEESPPFGGAHDQ
FT                   YWATCTGIVYPEAIRAENAVHSLEHGAVWVTYDPDHLSADDVTALAAHVDGVPYTLMSP
FT                   YPGLDSAVSLQSWGHQLRLDDVHDQRIADFLTALRQNPNTYPEPGATCSTVRGGFDPAD
FT                   PPPFDPSAPGPDAVPVDGN"
     atgacgaacg accgcagcga gagcccgcaa tcccggccga agccaggcgg gacgcgacgg        60
     cgtctgccct ggctgctcgc ggccgccgcg gtggcggtgg tgggggctgt cgccatcggt       120
     gcgtatgtac tgaccgccgg atccgacgac gcccgaaaag cccacgactt cgcacccagc       180
     gcggacaacc ctgacccgtc attgggaatc gaggggatcg tcaccgtcga ctatccgccc       240
     gccgaccatg tgcaagcgcc gcaacgagtg gcgtacgaag agagtccgcc gttcggtggt       300
     gcacacgatc agtactgggc gacgtgcacc ggaatcgtct atcccgaagc gatccgcgcc       360
     gagaacgccg tacattccct cgaacacggg gccgtgtggg tgacctacga cccggaccat       420
     ctgagcgccg acgacgtcac cgcactggcg gcgcacgtcg acggggtgcc gtacaccctg       480
     atgtcgccgt acccgggtct cgattcggcg gtgtccctgc agtcgtgggg tcaccaactc       540
     cgactcgacg acgtccacga tcagaggatc gccgacttcc tcacggctct acgacagaac       600
     ccgaacacct acccggagcc cggagcgacc tgttcgacgg tgcgcggcgg attcgacccc       660
     gccgacccgc cgccgttcga tccgtccgca ccgggtccgg atgcagttcc ggtggacggc       720
     aactag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page