(data stored in ACNUC7421 zone)

EMBL: AP011115.PE403

AP011115.PE403       Location/Qualifiers
FT   CDS_pept        complement(413485..413850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48650"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH3"
FT                   /protein_id="BAH48650.1"
FT                   /translation="MTNKAVVSLTTGLEDAEKVTVAFLVAVGAAEQQRQTLMFLTKEAV
FT                   RLALDGTIQGVACEGCPPLPDLAARFENAGGTYMVCPICFEAKHLDKDALVSNAELAGT
FT                   VPMWKWIGDEGAVTFSY"
     atgactaaca aagcagtggt cagtctcacc accggtctcg aggacgccga gaaggtgacg        60
     gttgcgtttc tggtcgcggt cggcgcggca gaacaacagc gccaaacgct gatgtttctc       120
     acgaaggaag cggtacggct cgccctcgac ggcacaattc agggcgtcgc atgcgagggt       180
     tgtccgccgc ttcccgatct ggcggcacga ttcgagaacg ccggcggcac ctacatggtg       240
     tgtccgatct gcttcgaggc caagcacctc gacaaggacg cgttggtatc caacgccgag       300
     ctcgccggga cggtgccgat gtggaagtgg atcggtgacg aaggagcggt cacgttcagc       360
     tactga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page