(data stored in ACNUC7421 zone)

EMBL: AP011115.PE404

AP011115.PE404       Location/Qualifiers
FT   CDS_pept        413977..414891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48651"
FT                   /db_xref="InterPro:IPR008585"
FT                   /db_xref="InterPro:IPR038128"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH4"
FT                   /protein_id="BAH48651.1"
FT                   /translation="MFEERPSQQISIVRLEVRRSRSTSANVAEHVGIHPRLLAGIGAEP
FT                   RQQVRVSREGTTALFTLVPGNGAGGIDTVQVTDGGCRRIGAESGHAVVLDLRCIDPTMS
FT                   EAEAEVEGEFIERLEDDGRHHRLAVLAPHGGAIESHTDRQAEQVYASLGSRDSTLWTCK
FT                   GWRPVGNAYRAWHISSGDLSVRSFPLLRSLAARRFRWAVSFHGYRGDDVLIGGRAPARL
FT                   KSEVLDAVATALDGTGIRVRVADPGERYSGESASNLVNRLTVGAAGGIQIEQPRSARTL
FT                   YGQAIAAAVGEVCESWIAADSGR"
     gtgttcgaag agcgtccgtc acagcagatt tcaatcgttc gcctcgaagt ccgtcgaagt        60
     cgatccacca gcgccaacgt cgccgaacat gtcgggattc acccgcgcct gctggccggg       120
     atcggagccg agccccgtca gcaggtgcgg gtgagtcgcg agggaacgac cgcactgttc       180
     acactcgtac caggcaacgg tgcaggaggg atcgacaccg tgcaggtaac tgatggtgga       240
     tgccgtcgga tcggcgccga gtccggacac gcagtggtcc tcgaccttcg gtgtatagac       300
     cccaccatgt ccgaggcaga ggccgaagtc gagggtgaat tcatcgaacg actcgaggac       360
     gacgggcgcc accaccgcct cgctgtcctc gcaccgcacg gcggcgccat cgaaagccac       420
     acggatcggc aggccgagca ggtttacgcg tcgctcggat cacgcgattc gacactgtgg       480
     acgtgcaaag ggtggcgacc ggtaggcaat gcgtaccggg cgtggcacat ttcctcgggc       540
     gatctcagcg tgcgcagctt cccgcttcta cgctccctgg ctgcacgccg attccggtgg       600
     gcggtgtcgt tccacggtta cagaggagac gacgtcctca tcgggggtcg tgcacccgca       660
     cgcctcaaat cggaagttct cgacgcagtc gcgacagcac tcgacggaac cggcatccgt       720
     gtgcgcgtag cggatcccgg cgaacggtac agcggtgaat cggcatccaa cctggtcaac       780
     cgcctgaccg tcggcgctgc gggtggaatc cagatcgaac agccccgatc tgcgcggacg       840
     ctgtacggac aagccatcgc cgccgctgtc ggcgaggtct gcgaatcctg gatcgccgcc       900
     gacagcggtc ggtga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page