(data stored in ACNUC7421 zone)

EMBL: AP011115.PE405

AP011115.PE405       Location/Qualifiers
FT   CDS_pept        complement(414935..416215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04050"
FT                   /product="putative serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48652"
FT                   /db_xref="GOA:C1ARH5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH5"
FT                   /protein_id="BAH48652.1"
FT                   /translation="MQSGALFGRYRLDRSLSVDENGEVWAAFDTVTARHVTVRALPRDA
FT                   SEDDEYCDRFVREAGLAAHIRNPHVVPIHDFGQIGNRLYLATPLTGGTNLRTILQASGP
FT                   MEATRAAGVVEQLASALEAVHATGLVEQGVTSGNVVVTDGGLVQLTDVGLPAAAGAAAG
FT                   VPSLSTVLYECLTGGQFASNGRELPSSKFSTLPVGMQAVIARGTAADPGRRYRSPSDLA
FT                   TAAARAAATGPQASADPAPETPPNGRNRRLLLAGLALAAIIAVAIVGGVIIGSQSSSPD
FT                   VVVPVPASSAAGPTSATSSTAAANPTAAEQVPPAAEAPVQDEVPPAETPAPQSPVLPVP
FT                   APAPAPAPAPAPAPAPAPPAASAPQVLPCYPGYEHTPPPDGPCLPPGSPPVPAPAPAPA
FT                   PAPQVLPCYPGYEHTPPPDGPCWAPGP"
     atgcaaagtg gagcgttgtt cggcaggtac cggctggacc ggtcgctgtc ggtggacgag        60
     aacggcgagg tgtgggcggc attcgacacc gtcaccgctc ggcacgtcac ggtgcgggcg       120
     ttgccgcggg acgcgagcga ggacgacgaa tactgcgatc gattcgttcg tgaagccggt       180
     ctcgcggcac acatccggaa cccgcacgtg gttccgattc acgacttcgg gcagatcggt       240
     aaccggctct acctcgcaac tccgctaacc ggcggcacga atctgcggac gatcctccag       300
     gcgagcgggc cgatggaggc aactcgcgcg gccggggttg tcgagcagct ggcgtcggcg       360
     ctggaggccg tgcacgccac ggggctggtc gagcagggag tgacgtcggg gaacgtcgtc       420
     gtgacggacg ggggactggt tcagctcacc gacgtcgggc tccctgccgc tgccggcgcc       480
     gcggcgggag tcccaagtct gagcaccgtc ttgtacgagt gtctgaccgg tgggcagttc       540
     gcgtcgaacg gccgggagtt gccgtcgtcg aagttctcca cgctgcccgt cggcatgcag       600
     gccgtgatcg cacgcggaac ggcagccgat cccgggcggc gctatcggtc gccgagcgac       660
     ctggcgacgg ccgccgctcg tgctgcggcg acagggccgc aggcttccgc ggatcccgct       720
     cccgaaaccc cgccgaacgg ccgcaaccgc cgtctcctgc tcgcgggact tgcgctcgcc       780
     gcgatcatcg ccgtcgcgat cgtcgggggc gtgatcatcg ggtcgcaatc gtcgtcgccc       840
     gacgtcgtgg tgcccgtgcc ggcgtccagc gcggctgggc cgacatccgc cacgtcatcg       900
     actgccgcgg cgaatccgac ggccgccgag caggtgccac cggccgcgga ggctcccgtt       960
     caggacgagg tcccgccggc ggaaactccg gcgccgcaat cgccggtact gccggtgcca      1020
     gcacccgcac ccgcaccagc acccgcacca gcacccgcac cagcgcccgc gcctccggcg      1080
     gcgtccgctc cgcaggtgct gccctgttac cccggctacg agcacacccc gcctccggac      1140
     ggaccgtgcc tcccacccgg ctcgccgccg gttccggcac cggcaccggc acccgcgcct      1200
     gcgcctcagg tgctgccgtg ctacccgggt tacgagcaca cgccgccccc ggacgggccg      1260
     tgctgggcgc ccggcccgtg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page