(data stored in ACNUC7421 zone)

EMBL: AP011115.PE406

AP011115.PE406       Location/Qualifiers
FT   CDS_pept        complement(416349..416843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48653"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH6"
FT                   /protein_id="BAH48653.1"
FT                   /translation="MRRAGKILAGIGMATVITATGQGIAVAAPEGTTESVTTLQVPPIG
FT                   MSPVLAAYFTVDAVTGRVPGVVRFRTVSECYVLNPISADTCIPGPGNAMRANAVRVHWL
FT                   NMNTGATGAVTIPIGTAGSTDSPRPEIDVATGSGRIVVGTMAPAEYPQALLPGFGTFDV
FT                   P"
     atgcgtagag caggaaagat tctcgccgga atcggcatgg caacagtgat caccgccacc        60
     ggtcagggca ttgcggtcgc ggcgcccgag ggtacgacgg aaagcgtgac gaccctgcag       120
     gtcccgccca tcgggatgag cccggtactc gccgcctact tcaccgtcga cgcagtcacg       180
     ggtcgggtac ccggagtcgt gcggtttcgc accgtgagcg agtgttacgt cctgaatccc       240
     atcagcgcgg acacgtgcat tcccggaccg ggtaacgcca tgcgggcgaa tgctgtgcgg       300
     gtgcactggc tgaacatgaa caccggggcg accggcgcgg tcacgatccc catcgggacc       360
     gccgggtcga ccgattcgcc gcgtcccgag atcgacgtgg ccaccggcag cgggcgaatc       420
     gtcgtcggca cgatggcccc ggccgagtat ccacaggcgt tgcttccggg cttcggcacc       480
     ttcgacgtgc cctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page