(data stored in ACNUC7421 zone)

EMBL: AP011115.PE408

AP011115.PE408       Location/Qualifiers
FT   CDS_pept        complement(417234..417623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48655"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH8"
FT                   /protein_id="BAH48655.1"
FT                   /translation="MKVTATATRRGGSWVVKVPGVEGAVTEARRLDQISAMVAEAVHLV
FT                   EGVRAEDVEVELDYDIGDPAALMEARAAHWQVESAAHAQECAARASRAAVAHLRRSGLS
FT                   VRDIGVILDLSPQRVSQLDRAGLHA"
     atgaaggtga cggcgacggc cacccgtcgc ggtggatcgt gggtggtgaa ggttccggga        60
     gtcgagggcg cggtcaccga ggcgcggcga ctcgatcaga tttccgccat ggtggcggag       120
     gccgtgcatc tggtcgaagg tgtgcgggcc gaggacgtcg aggtggaact cgactacgac       180
     atcggagatc cggcggcgct catggaggca cgcgccgccc actggcaggt cgagtccgcc       240
     gcccacgctc aggaatgtgc agcgcgggcc tcgcgggcgg cggtggcgca tcttcgccga       300
     tcgggtctct cggtgcgtga catcggtgtc atcctcgacc tgagcccgca acgggtctcc       360
     cagctcgacc gcgccggcct tcatgcctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page