(data stored in ACNUC7421 zone)

EMBL: AP011115.PE409

AP011115.PE409       Location/Qualifiers
FT   CDS_pept        complement(417765..420794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04090"
FT                   /product="putative serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48656"
FT                   /db_xref="GOA:C1ARH9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR030605"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH9"
FT                   /protein_id="BAH48656.1"
FT                   /translation="MADFDPDATQAASVRAVGHGIVAELDAAGFAGAEEVGRGGFGVVY
FT                   RCLQRSLGRIVAIKVLTSDLDSENRERFLREGYAMGGLSGHPNIVNILQVGVTETGRPY
FT                   IVMHYHPRDSLAVQIRREGPLPWPEAISIGVKLAGALETAHRTGTLHRDIKPANILLTD
FT                   YGEPQLTDFGIAHIAGGYETATGGFTGSLAFTAPEVLNGESPTARSDVYGLGATIFSLI
FT                   AGRAAFERKTGEELVAQFVRISTQTVPDLRAQGIPDGVCAVIERAMAPNPFARPASAEE
FT                   FGHELQAAQRHIGLRSDAMALAPLEPAQPGQAHPAADAGGYRQIRFEDSDGQRRFFAST
FT                   EQIQPDSHPSAPFWPPTGPSPWPPPEARGRSGPARGRRRGILIVLALVVTLVLAGGGYL
FT                   VFREATGPGTAGPIAQDGGEPPAVDPTAAWRPVGDARVARQQTATTVADGTIWVFGGLD
FT                   DNGVSARQEGYDPAIDTWKAGPDLPVPLNHAMAVTYNDEPVLIGGWQAKGQNLTAVASA
FT                   RVMAMRDGRWVDLPPLNVPRAAGAAAVVGDRIVVAGGQADGELVSPTEVFDGTKWTTVA
FT                   HIPTSREHLAGVSDGKYFYAIGGRDLASDQNTAAVERFDPVAGTWATLPGMPTPRGGLG
FT                   ATFIDGRIVAVGGEEPTRVLSTVEAYDVVAGSWSQLPALRTPRHGMAVGAVGNTVYAVG
FT                   GGIKPTHAESTAVSEALQIAPRKTQWAPAWRPLRDAPIARQQTATAVADGTIWVFGGLD
FT                   NVGSTAKVEGNDPAIDTWKAGPDLPVPLNHAMAVEYGGELVVLGGWVPEGPNLTGKTSD
FT                   RVLALRDGNWVDLPPLNVPRAAGAAAVVGDRIVVAGGQADGELVASTEVFDGTKWTTVE
FT                   DIPTSREHLAGVTDGKYFYAIGGRDLASDQNTAAVERFDPVAETWATLPGMPTPRGGLG
FT                   AAFIDGRIVAVGGEQPTRVLSTVEAYDITSGTWSALPPMPTGAHGMSVAAVGHTVYAIG
FT                   GALRPTHAESTATAQALDFW"
     atggcagatt tcgacccaga cgcgacccag gcggcgtcgg tccgcgcagt cggccacggg        60
     atcgtggcgg agttggacgc tgccggattc gcgggtgccg aggaggtggg ccggggcggg       120
     ttcggtgtcg tgtaccgctg cctgcagcgt tcgctcggtc gcatcgtcgc gatcaaggtc       180
     ctgacgtcgg acctcgactc cgagaaccgc gagcgtttcc tgcgggaggg ctacgcgatg       240
     ggcggactct ccggccaccc gaacatcgtc aacatcctgc aggtcggcgt gaccgagacc       300
     ggtcgcccgt acatcgtcat gcattaccac ccccgcgact cgctggcagt gcagatccgc       360
     agagaaggtc cgctgccctg gccggaggcg atcagcatcg gagtgaagtt ggcgggtgca       420
     ctggagacgg cgcaccggac cggcaccttg catcgcgaca tcaagccggc gaacatcctg       480
     ctcaccgact acggcgagcc gcagctgacc gatttcggca ttgcgcacat cgccggcggt       540
     tacgagaccg ccacgggcgg gttcaccggg tcactggcgt tcaccgctcc ggaagtcctc       600
     aacggcgaat cgccgaccgc gcgttcggac gtctacggtc tgggcgcgac gatattttcg       660
     ctgatcgcgg ggcgggcggc gttcgaacgg aagaccggcg aggaactcgt tgcgcagttc       720
     gtgaggatca gcacccaaac ggtgccggac ctgcgcgctc aaggcatccc ggacggtgtg       780
     tgcgccgtca tcgagagggc gatggcgccg aacccgttcg cccggccggc ctccgccgag       840
     gaattcggcc acgaactcca agccgcccag cgacacatcg ggttgcgttc ggacgcgatg       900
     gcgttggcac ccctggagcc cgcccagccg ggccaggcgc acccggccgc ggatgcgggt       960
     ggctaccgtc agatccggtt cgaggattcg gacggtcagc gccgattctt cgcatcgacc      1020
     gagcagatcc agcccgattc ccacccctcg gccccgttct ggccgccgac gggtccgtcg      1080
     ccctggccgc cgccggaagc gcggggtcgc agtgggccgg cccgcggccg gcggcgcggg      1140
     atcctgatcg tgctcgcact ggtggtgacg ctggtgctgg ccggtggcgg ttacctcgtg      1200
     ttcagggagg caaccggacc cggcaccgcg gggccgatcg cccaggatgg cggtgaaccc      1260
     ccggccgtcg acccgaccgc ggcgtggcgg ccggtcggcg acgcccgtgt cgcccgacag      1320
     cagacggcga cgacggtggc ggacgggacc atctgggtgt tcggagggtt ggacgacaac      1380
     ggtgtctccg cccggcagga gggctacgac ccggccatcg acacctggaa ggcgggcccc      1440
     gatctccccg tcccgctcaa tcatgcgatg gccgtcacct acaacgacga gcccgtactc      1500
     atcggcgggt ggcaggcgaa aggccagaac ctcactgccg tcgcctccgc acgggtgatg      1560
     gccatgcgcg acggtcgatg ggtggacctg cccccgctga acgtgccgcg ggcggccggt      1620
     gccgccgccg tggtcggcga caggatcgtg gtcgccgggg gacaggcgga cggcgaactg      1680
     gtttcgccga cggaggtgtt cgacggcacg aaatggacga cggtcgcgca cattccgacg      1740
     tcacgggagc acctggccgg ggtgtcggac gggaagtact tctacgcgat cggcgggcgt      1800
     gacctcgcgt cggatcagaa cacggccgcg gtcgaacggt tcgatccggt tgcgggaacg      1860
     tgggcgacgc tgcccggcat gcccaccccg cgtggcgggc tcggggcgac gttcatcgac      1920
     ggccgcatcg tcgcggtcgg cggtgaggaa ccgacccgcg tgctgtcgac ggtcgaggcc      1980
     tacgacgtgg ttgcagggtc gtggtcgcaa cttcccgccc tgcgcacgcc ccggcacggg      2040
     atggcggtcg gcgcggtcgg caacacggtg tacgcggtcg gcggcggcat caaacccacg      2100
     cacgccgaat cgacagcagt gtccgaggca ctgcagatcg cgccgcgcaa gactcaatgg      2160
     gcgccggcgt ggcggccgct cagggacgcg ccgatcgccc gccagcagac cgcgacggcc      2220
     gtcgcggacg ggacgatctg ggtgttcggc ggactcgaca acgtggggtc gaccgcgaag      2280
     gtcgagggca atgacccggc catcgacacc tggaaggcgg gcccggacct tccggtcccg      2340
     ctcaatcacg cgatggccgt cgaatacggc ggcgagttgg tggtcctcgg aggctgggtg      2400
     ccggaagggc cgaacctcac cgggaagacg tcggaccggg tgctcgcgct gcgggacggc      2460
     aactgggtgg acctcccccc gctgaacgtg ccgcgggcgg ccggtgccgc cgccgtggtc      2520
     ggcgacagga tcgtggtcgc cgggggacag gcggacggcg aactcgtggc gtcgacagaa      2580
     gtcttcgacg gcacgaaatg gacgaccgtc gaagacattc cgacgtcacg agagcatctg      2640
     gccggggtga cggacgggaa gtacttctac gcgatcggcg ggcgcgatct ggcgtcggat      2700
     cagaacacgg ccgcggtcga acggttcgat ccggtggcgg agacgtgggc gacgctgccc      2760
     ggcatgccca ccccgcgcgg tgggttgggg gcggcgttca tcgacggacg tatcgtcgcg      2820
     gtcggcggtg aacagccgac ccgggtgctg tcgactgtcg aggcctacga catcacctcg      2880
     gggacctggt cggcgttgcc gccgatgccc accggagccc acgggatgtc cgtcgcagcg      2940
     gtcgggcaca ccgtgtacgc catcggcggc gcgcttcggc ccacgcatgc cgagtcgact      3000
     gcgaccgcgc aggcactcga tttctggtga                                       3030
//

If you have problems or comments...

PBIL Back to PBIL home page