(data stored in ACNUC7421 zone)

EMBL: AP011115.PE41

AP011115.PE41        Location/Qualifiers
FT   CDS_pept        complement(34898..35314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48288"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS39"
FT                   /protein_id="BAH48288.1"
FT                   /translation="MGLRGAVDTCARVYPLGYGGEVLGDTPSGMKELEMREVDLDEFAV
FT                   RWADGVPVVDVRERWEYVDGHVPGALLMPLGQLAARTAEIPAGEVVYVICASGNRSREG
FT                   ARIVEAAGRGAVSVAGGTSGWAAHGRPLDRGDGS"
     gtgggcctgc gcggtgcggt cgacacttgc gcccgggtat accccctggg gtacggtggg        60
     gaagtcctcg gagatacccc ctcgggtatg aaggagttgg agatgcgtga ggtagacctc       120
     gatgaattcg ccgtgcgctg ggccgacggc gttccggtcg tggatgtgcg cgagcggtgg       180
     gagtacgtcg acggacacgt tccgggggcg ttgctgatgc cgctcgggca actcgccgcc       240
     cgcaccgcgg agattcccgc gggggaggtc gtctacgtga tctgcgcgtc cggcaaccgc       300
     agccgcgagg gggcccggat cgtcgaggcc gccggccgcg gcgcggtctc ggtcgccggg       360
     ggcacctccg gctgggccgc ccacggccgg cccctcgaca ggggcgacgg atcctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page