(data stored in ACNUC7421 zone)

EMBL: AP011115.PE410

AP011115.PE410       Location/Qualifiers
FT   CDS_pept        complement(421047..422453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48657"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI0"
FT                   /protein_id="BAH48657.1"
FT                   /translation="MESLPDSGMLLAVLEHSPALVFVSEFVSGRIVYVNPAGVGVLGFG
FT                   DAVHAYSRTTAELFTDVGLVQAREVESALADRGEWTGLTEFRHFVTGEPIPMLISTFVL
FT                   EYAETGPSVIGSIAQDRRGAEDDEQRLQRALGESAYRAREQQAIADLSQLAVGGDLDEL
FT                   LSAAAGAAAALMGVHCSSIARVSDDGELTVLAYRGPEPCPKTFAPGPGSQPGYAAADGS
FT                   VIVCTDRVHETRFSTAGMSGRGLQSGVCVPFGSDAVWGVLTAHSRRPREYTDRDLTFLR
FT                   SVTAVLSAAIRRIEAEAALVHQSLHDPLTGLPNRTLARRRLDEALDAVPRGGPRVALLL
FT                   VDLDDFKTVNDSLGHAVGDDALIVLARHLRSAVRPGDTVARLGGDEFVVVCEHVAGAAE
FT                   AVAIAARIAGSFADLNRARSLEWPISASIGVALSDPEGTREELVRRADAAMYRAKAAGA
FT                   GGYALYDDTF"
     atggagtcgc tgccggattc ggggatgctg ctcgcggtcc tcgaacacag tccggcgttg        60
     gtgttcgtgt ccgagttcgt gtccggtcgg atcgtgtatg tcaatcccgc gggtgtcggt       120
     gtcctcggat tcggtgatgc cgtgcatgcg tactcgagga cgacggcgga actgttcacc       180
     gacgtcggtc tcgtgcaggc gcgtgaggtg gagtcggctc tggccgaccg gggagagtgg       240
     accgggttga cggaatttcg ccacttcgtc acgggcgagc cgatcccgat gctgatttcg       300
     actttcgtgc tcgaatacgc ggagaccggg ccgtcggtga tcgggtcgat tgcccaggat       360
     cgccgcggcg ccgaagacga cgagcaacgc ctgcagcgcg cactggggga gtccgcatac       420
     cgggcccgcg agcagcaggc gatcgcagac ctgagccaac tcgccgtcgg cggagacctc       480
     gacgaactcc tctcggcggc ggccggggcg gcggccgcgc tgatgggtgt gcactgttcg       540
     tcgatcgccc gggtatccga cgacggcgaa ctcaccgtgc tcgcctaccg cggacccgag       600
     ccctgtccca agacattcgc cccggggccg ggatcacagc ccgggtacgc cgccgccgac       660
     gggtcggtga tcgtgtgcac cgatcgggtc cacgagaccc ggttctccac ggcggggatg       720
     agcgggcgcg ggctgcagag cggggtgtgc gttccgttcg gctccgatgc ggtgtggggc       780
     gtgttgacgg cgcacagtcg tcgcccccgc gaatacaccg accgtgacct cacctttctg       840
     cgctcggtga cagccgtgct ttccgcggcg atccgccgta tcgaggccga ggccgccttg       900
     gtgcaccaga gcctgcacga cccgctgacg ggattgccga accgcactct ggctcgccgc       960
     cggctcgacg aggccctgga cgcggtgccg cgcggcggcc cgcgcgttgc gctgttgctg      1020
     gtggatctcg acgacttcaa gaccgtcaac gacagcctcg gtcacgcggt cggcgacgac      1080
     gcgctgatcg tgctcgcccg gcatctgcgg tcggcggtgc gtccgggcga taccgtggcc      1140
     cgcctcggtg gtgacgaatt cgtggtcgtc tgtgagcacg tcgcgggcgc ggcggaggcg      1200
     gtcgcgattg ccgctcggat cgccgggagt ttcgccgacc tgaaccgggc acggtcactc      1260
     gagtggccga tcagcgccag tatcggtgtc gcactgtccg atccggaggg cactcgtgaa      1320
     gagctcgttc ggcgggcgga tgcggcgatg tatcgtgcaa aggccgcggg agccggcggg      1380
     tacgcgctct acgacgacac cttctag                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page