(data stored in ACNUC7421 zone)

EMBL: AP011115.PE411

AP011115.PE411       Location/Qualifiers
FT   CDS_pept        422636..423124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48658"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI1"
FT                   /protein_id="BAH48658.1"
FT                   /translation="MGMRRARWPAFAPPTASGTAVHGPTILASGTHLTLDLLGIVAFSS
FT                   GIHVRLALTATGRTAERAHHETRLLSDPADPDTQWSYLSVLLQLGSVVGVADPYLPRSG
FT                   SPRKWGGVPAYRTEPNYWLGTCTRPHDIMISAGWPEIGLGPTCLTALLEPSPSTVTSD"
     gtgggcatgc gcagagcgcg ttggccggca ttcgcgccgc cgacagccag tgggaccgcg        60
     gtgcacggtc ccaccatcct cgcgtccgga actcacctca ccctggacct cctgggaatt       120
     gtcgcgttct cgtccggaat ccacgtccgt ctcgccctga ctgccacggg gcgcaccgcc       180
     gagcgtgcac accacgagac tcggctgctg tccgatccgg cggaccccga cacccagtgg       240
     tcgtatctgt cggtgctgct gcagttgggc tctgtcgtgg gcgttgccga cccctatctg       300
     ccacggtccg gttcaccccg gaagtggggt ggagtgcccg cctaccgcac ggagccgaac       360
     tactggctcg gcacgtgtac gcgaccgcac gacatcatga tctcggcggg gtggccggag       420
     atcggcctgg gtccgacgtg cctcaccgct ctcctggaac cgagcccgtc gaccgtcacc       480
     tccgactga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page