(data stored in ACNUC7421 zone)

EMBL: AP011115.PE412

AP011115.PE412       Location/Qualifiers
FT   CDS_pept        complement(423159..424436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04120"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48659"
FT                   /db_xref="GOA:C1ARI2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI2"
FT                   /protein_id="BAH48659.1"
FT                   /translation="MAESSVLPADLGGSPDLERIVLEHAYRGAHLQLALRGVLVLFIAL
FT                   TLVFVPPTNDANVCVAVLIGYALWTVGLAMWTRRGGPGPVNAIWLALFVDLAVIGSLTL
FT                   LTGIAAQQSWTADILTNGLFVIPLLACTQLRPGVCASVVVPTVLVFLAASWATMASNEE
FT                   PWSSILLSTMALAILSAGAVVLSRIQRSRVLTIGHLVHDRTALLAELMGLEQRERRALS
FT                   EQLHDGALQFVLAAKMDLDDLTGGADPEAVDRITHALTESATLLRATVSELHPTVLDRV
FT                   GLARALGDIVRSAQARGGFDVDLQTVEWDDDLRTSADDVLFSAARELLSNVVKHARART
FT                   VRVELSRTGGHAVLDVTDDGCGISREAIDRSLSRGHIGLTSHELRVVAAGGSFSVRPGP
FT                   RSGTVARIEMPFEVVTASDSLTISAH"
     atggctgagt catcggtatt gcccgcggat ctcggcggca gcccggatct cgaacgcatc        60
     gtcctcgagc acgcatatcg aggcgcgcat ctgcaactcg cgcttcgtgg tgtgctggtg       120
     ctcttcatcg cgttgacact ggtgttcgtc ccgcccacga acgacgcgaa tgtgtgcgtg       180
     gcggtcctga tcggctacgc gctctggacc gtcgggctcg cgatgtggac ccgtcgaggc       240
     ggtccggggc cggtgaacgc gatatggctc gccctgttcg tggaccttgc cgtcatcggt       300
     agtctcaccc tgctgacggg gattgcggcg caacagagtt ggaccgcaga catcttgacc       360
     aacggactgt tcgtgatccc gctactggcc tgcactcagc tccgcccggg ggtctgcgcc       420
     tccgtcgtcg tgccgacggt cctggtgttc ctcgccgcca gctgggccac gatggcgtcg       480
     aacgaggaac cgtggtcgtc cattctgctc agcacgatgg cacttgccat cctgtcagcg       540
     ggcgcagtcg tgctgagcag aatccaacga tccagggtgc tcaccatcgg tcacctcgtc       600
     cacgaccgca ccgccctgct cgcggagttg atgggcctcg aacagcgcga acgacgtgcg       660
     ttgtccgaac aactccacga cggagcgctg cagttcgtgc tggccgcgaa gatggatctc       720
     gacgacctca ccggcggcgc ggatccggag gccgtcgatc gcatcaccca cgcactcacc       780
     gaatccgcga cgctgctgag ggccaccgtc tcggaacttc atcccacggt gctcgatcgc       840
     gtcggacttg cccgcgctct cggcgacatc gtccggtccg cccaggcgcg tggcggtttc       900
     gacgtggatc tccagacggt ggaatgggac gacgacttgc gtacgtcggc cgacgacgtg       960
     ctgttcagcg cggcacgcga attgctcagc aacgtggtca agcatgcgag agcccgcacc      1020
     gtccgcgtcg agctgtcgcg gacgggtggg catgcggttc tcgacgtcac cgacgacggg      1080
     tgcggcatct cccgtgaagc gatcgaccgc agtctgagtc ggggacacat cggactgacg      1140
     tcgcacgaac tccgcgtcgt cgcagcggga ggcagtttct ccgtccgtcc cggaccacgt      1200
     tccgggacgg tagcccgcat cgagatgccg ttcgaggtcg tcacagcgtc cgattccctc      1260
     acgatctcgg cgcactag                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page