(data stored in ACNUC7421 zone)

EMBL: AP011115.PE413

AP011115.PE413       Location/Qualifiers
FT   CDS_pept        424683..425597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48660"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI3"
FT                   /protein_id="BAH48660.1"
FT                   /translation="MTRIRRRSAVALASIAGASVLLLAACTQDASSIDGTESAAPGATS
FT                   ESPAAEPAVDGVDAKQYASSDPATETYGFVTPSGKWLCAIIPAKQLAGCASHPTAGPLG
FT                   VPGTPQIASPNGGPPAEADLIAIEAGKEPNFQNWNQALFPGNANVLPYDTTLAVDGFSC
FT                   NVQFSGVSCREDATNKGFTVSTNGYKFEFTPLPMSVPSASPPPIAPTAAPLPQQARGSN
FT                   QCGPITYPETGKPATVVIVKGTLRCDEAHTMLTKYFTGRDKSEPVYSFDGWECRLAGDP
FT                   ESAEIGYTINCTDDNGNSVVAQP"
     atgaccagga ttcgacggcg gtccgcggtg gcgctggcct cgatcgccgg tgcctcggtt        60
     cttctgctcg ctgcctgcac ccaggatgcg tcgtcgatcg acggcaccga gtccgccgca       120
     ccgggcgcca ccagcgagtc accggcagcc gagccggcgg tcgacggcgt cgatgcgaag       180
     cagtacgcgt cgagcgaccc ggcgaccgag acgtacggct tcgtcacacc gtcgggaaaa       240
     tggttgtgcg cgatcattcc cgcgaagcag ctcgccggat gcgcttcgca tcccaccgcg       300
     gggcccttgg gggtccctgg caccccgcag atagcgtcgc cgaacggcgg cccgcccgcc       360
     gaggccgacc tcatcgcgat cgaggcggga aaggagccga acttccagaa ctggaaccag       420
     gcactgttcc ccggcaacgc caatgtcctc ccctatgaca ccacgctggc ggtcgacgga       480
     ttcagctgca atgtgcagtt ctcgggagtc tcgtgccgag aggatgcgac gaacaagggc       540
     tttaccgtct ccaccaacgg gtacaagttc gaattcaccc cgctgccgat gagcgttccc       600
     agtgcgagcc caccgccgat cgcacctacc gccgcacctc tgccgcagca ggctcgtgga       660
     tcgaatcagt gtggccccat tacctatccg gaaacgggaa agcccgcgac cgtggtcatc       720
     gtgaagggga cactccgctg cgacgaggcg cacacgatgc tcacgaaata cttcaccggc       780
     cgcgacaaga gtgaaccggt gtacagcttc gacgggtggg aatgccgcct cgcgggagac       840
     ccggaatcgg cggagatcgg ctacacgatc aactgcaccg acgacaacgg gaacagcgtc       900
     gtcgcacagc cgtag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page