(data stored in ACNUC7421 zone)

EMBL: AP011115.PE414

AP011115.PE414       Location/Qualifiers
FT   CDS_pept        425694..426011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48661"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI4"
FT                   /protein_id="BAH48661.1"
FT                   /translation="MQPPNDQAGTWEGSWLAAMTVIKSAQRVFTPDNRPPSELIPLVEP
FT                   LSRLGDALRATPPDPEESRRRAADLVADRDLITWACRPDQPRDIRELGATLAFLSMKLT
FT                   T"
     atgcaaccac cgaatgacca ggccggtacc tgggaaggct cgtggctcgc ggcgatgacg        60
     gtgatcaaga gcgctcagcg ggtgttcacg ccggacaacc gcccaccttc cgagctcatc       120
     ccgctcgtcg aacccctgag ccggttgggt gacgcgctac gggcaacacc gcccgacccc       180
     gaggagtcgc gtcgtcgcgc ggccgacctg gtcgccgatc gggacctgat cacctgggca       240
     tgccgaccgg accagccccg cgacatccgg gaactcgggg cgaccctggc cttcctgtcc       300
     atgaagctga ccacctga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page