(data stored in ACNUC7421 zone)

EMBL: AP011115.PE416

AP011115.PE416       Location/Qualifiers
FT   CDS_pept        427108..428667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48663"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI6"
FT                   /protein_id="BAH48663.1"
FT                   /translation="MRIARIRRGVASSALAVSVVLGVATSPAPAIASAETYVFDDVGST
FT                   AVPRADCGPGSLPETGMQGDVPAEDRNNGRSTQGYRCNMSLIGGLQDRGGGLLSVTYDH
FT                   CSYTSTFFPGNLLDPDTPGVQVLDVSDPAQPVLSTTLNEPAMLGGTWESLKVNKARKLL
FT                   AATAVPAAAGTGYFSVYDISDCAHPRLLNRGAGTDVTMPLPFLSHEGGFSPDGNTYWVS
FT                   GPAPGFLTAIDIRNPAEPRITWQGLHGLGGHGFGITPDGNRMYLSNLGGITVLDISAVQ
FT                   RGDPYPTVPQLATYLWTDGFFNQHSIPVTYGGKPHIFTVDETGGGGIKVFDVADPAHAD
FT                   IVQKVKLEIQLPANTAANLRSSQGGSVFSYDPHYCVVDRPSDPTALACSWESSGIRVFD
FT                   IRDLDDIREIAYYNPPAQTGKNLQLTNSPHALSSLIGVSLFDFVPLARAVFEGKADPRV
FT                   AFGPRAGMVAFGDLSADWCFSPPEFHGNQIWTSCSDNGFMALQLDESVYQAPANQDSTY
FT                   GQ"
     atgcggatcg ccagaatacg gcgaggtgtg gctagctcgg ccctcgccgt gtcggtcgtg        60
     ctcggggtcg cgacgagccc cgcacccgcc atcgcgtcgg ccgagaccta cgtcttcgac       120
     gacgtcggtt cgacggcggt tccgcgggcg gactgcggtc ccggttcgct gccggagacg       180
     ggtatgcagg gcgacgttcc ggccgaagac cgcaacaacg gacgaagcac ccaaggttat       240
     cgatgcaaca tgtcgctgat cggcggcctg caggatcgcg gtggtggcct gctgtcggtg       300
     acctatgacc actgctccta caccagtacg ttcttccccg ggaatctcct cgaccccgac       360
     acgcccggcg ttcaggtgct cgacgtgtcg gaccccgccc agccggtgct gtccaccact       420
     ctgaacgaac ccgcgatgct gggcggcacc tgggaaagtt tgaaggtcaa caaggcacgg       480
     aaattgctgg cagccacggc cgtcccggcc gccgcaggca ccggctactt ctccgtctac       540
     gacatttccg actgcgccca cccccggttg ctcaaccgag gagccggaac cgacgtcacc       600
     atgccgctgc cgttcctctc acacgaaggc ggcttctccc ccgacggcaa cacctactgg       660
     gtgtccggcc ccgccccggg atttctcacc gccatcgaca tcagaaaccc ggccgagcca       720
     cggatcacct ggcagggact gcacggactc ggcgggcacg gtttcggtat cacgcccgac       780
     gggaaccgga tgtacctgtc caacctcggt gggatcacgg tcctcgacat cagcgcggtg       840
     cagcgcggcg acccgtatcc caccgtgccg caactcgcca cgtatctgtg gaccgacgga       900
     ttcttcaatc agcacagcat tccggtgacg tatgggggga agccccacat cttcaccgtc       960
     gacgaaaccg ggggcggtgg gatcaaggtc ttcgacgtcg ccgacccggc gcacgccgac      1020
     atcgtgcaga aggtcaagct cgagatccag cttcccgcca acaccgccgc gaaccttcgg      1080
     tcctcgcagg gcggctcggt gttctcctac gatccccact actgcgtggt cgaccgcccc      1140
     tcggacccga ccgcactcgc gtgctcctgg gagtcgtccg ggatccgcgt gttcgacatc      1200
     cgcgacctgg acgacatccg ggagatcgcc tactacaacc caccggcaca gaccggcaag      1260
     aatctccagc tgaccaactc accacacgcg ctgtcgtcgc tgatcggtgt gtcactcttc      1320
     gatttcgttc cgctcgcccg cgccgtcttc gagggcaagg cggatccgcg cgtggcattc      1380
     ggtccacgag ccggaatggt ggcgttcggt gacctgtccg cggattggtg cttctcgccg      1440
     ccggaattcc acggcaacca gatctggacc tcgtgcagcg acaacggttt catggcgctg      1500
     cagttggacg agtccgtcta tcaagcaccg gcgaaccagg attcgacgta tggccagtga      1560
//

If you have problems or comments...

PBIL Back to PBIL home page