(data stored in ACNUC7421 zone)

EMBL: AP011115.PE417

AP011115.PE417       Location/Qualifiers
FT   CDS_pept        428657..429310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48664"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI7"
FT                   /protein_id="BAH48664.1"
FT                   /translation="MASDTRRSRFRRPVVLLLCAVLLGAGGVAAGMWLQSAREQLVGRV
FT                   QLSPADVGFAQDMSVHHEQAVLIAQTLPRDVDPQIRVIADQIVVAQTSEIATMRGWLNL
FT                   FDEAFTTAHPMQWMHGSDHVMSEQGGAPMPGTASTSEISRLAGLRGADAEALFLQLMIR
FT                   HHQGGVEMAEAAIHAVASEPIRRVARGMIRDQSNEIAVMTALLGTRDAKPLPHP"
     atggccagtg acacacggcg ttcgcgattc cgccgtcccg tcgtcctgtt gctgtgcgcc        60
     gtgctgctcg gtgccggcgg ggttgcggcc ggtatgtggc tgcagtcggc gcgcgagcaa       120
     ctcgtcggcc gggttcagct gtccccggcc gacgtcggtt tcgcacagga catgtcggtg       180
     caccacgaac aagcggtgct gatcgcccag accctgccgc gggacgtcga cccacagatc       240
     cgggtcatcg ccgaccagat cgtcgtcgcg cagacttccg agatcgcgac gatgcgcggc       300
     tggctcaacc tcttcgacga ggcattcacc acagcgcatc cgatgcagtg gatgcacggt       360
     tccgatcacg tcatgagcga acagggcggc gcaccgatgc cgggaacggc gagcacgagt       420
     gagatcagcc ggctcgccgg cctgcgcggt gcagacgcgg aggcactctt tctgcaactc       480
     atgatccggc accaccaagg cggcgtcgag atggcggagg cagctatcca cgcggttgcc       540
     tcggaaccga tccgccgcgt cgcacgcggg atgatccgcg accagagcaa cgagatcgcc       600
     gtgatgacag cactactcgg cactcgagac gcgaaaccgc ttcctcaccc ctag             654
//

If you have problems or comments...

PBIL Back to PBIL home page