(data stored in ACNUC7421 zone)

EMBL: AP011115.PE418

AP011115.PE418       Location/Qualifiers
FT   CDS_pept        complement(429421..429750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48665"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI8"
FT                   /protein_id="BAH48665.1"
FT                   /translation="MSATIRSLVIPVSDLDAAKAVYTALLGEPHTDQPYYVGYNVDGFE
FT                   VALNPGEEGGGPVAFADVEDLDAARATLLEAGATERSAPRQVAAEARVCVLADADGNPI
FT                   GLRGK"
     atgagtgcca cgatccgcag cctggtgatt ccggtgtccg acctggacgc cgcgaaggcc        60
     gtctacaccg ctttgctcgg cgaaccgcac accgaccagc cctattacgt cggatacaac       120
     gtcgacggct tcgaggtcgc tttgaatccc ggcgaagagg gcgggggacc ggtggccttc       180
     gccgatgtcg aggatctcga tgcggcccgc gcgaccctcc tcgaggcagg tgccaccgag       240
     cgcagcgccc cgcgccaggt cgccgcggag gcgcgggtgt gcgtgctcgc cgacgccgac       300
     ggcaacccga tcggtctgcg cggcaaatag                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page