(data stored in ACNUC7421 zone)

EMBL: AP011115.PE420

AP011115.PE420       Location/Qualifiers
FT   CDS_pept        complement(430705..431088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48667"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ0"
FT                   /protein_id="BAH48667.1"
FT                   /translation="MMTPPDEYVSVRYLVDDVAAAIDFYTSHLGFTLHTNPAPAFADVT
FT                   RGSLTLLLSGPASSGARATPADNAGAGRNRIHLIVGDLDDEVTRLRDAGVTFRSDVVVG
FT                   PGGRQILLADPSGNLVELFQPAT"
     atgatgaccc cacccgacga atacgtcagc gtccgctacc ttgtcgatga tgtggccgcc        60
     gccatcgact tctacaccag ccacctcggt ttcaccctgc acacgaatcc ggcccctgcc       120
     ttcgccgacg tgacccgcgg ttcgctgacg ctgttgctgt cgggcccggc tagttcgggg       180
     gctcgcgcaa cacctgccga caatgccggt gcgggcagaa atcgcattca cctgatcgtc       240
     ggcgacctcg acgacgaagt cacccgccta cgcgatgccg gcgtcacatt ccgcagcgat       300
     gtggtcgtcg gtccgggcgg tcgtcagatc ctgctcgccg acccttccgg caatctggtc       360
     gaactgttcc agcccgcgac ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page