(data stored in ACNUC7421 zone)

EMBL: AP011115.PE421

AP011115.PE421       Location/Qualifiers
FT   CDS_pept        complement(431396..431770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48668"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ1"
FT                   /protein_id="BAH48668.1"
FT                   /translation="MEWSVARVAGDDRDTAGPSAAADRGSSGSGYRPSLESAPNPTPRR
FT                   AVRQLRCLRLRSHRRSTFCDRRSRYRGARTLYCPPNEEHWHGAGTDSFMEHLAMLDNAD
FT                   DPATTTTWLEHVTDDEYLAE"
     atggagtggt ccgtcgcacg tgttgctggg gatgatcgtg acaccgctgg cccgtcggcg        60
     gccgcagatc gcggctcgtc cggttctggc tatcgaccat ctctcgagtc ggcgcccaac       120
     cccacgccaa ggagggccgt ccgccaactt cgatgtcttc gacttcgatc tcaccgccga       180
     tcaacttttt gcgatcgacg ctctcgatac cggggtgcgc ggaccctcta ctgcccaccg       240
     aacgaagaac actggcacgg agccggtacc gactcgttca tggaacacct ggcaatgctc       300
     gacaacgctg acgacccggc caccaccacg acctggctgg aacacgtcac cgacgacgaa       360
     tacctggctg aatag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page