(data stored in ACNUC7421 zone)

EMBL: AP011115.PE427

AP011115.PE427       Location/Qualifiers
FT   CDS_pept        436411..437697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48674"
FT                   /db_xref="GOA:C1ARJ7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR040570"
FT                   /db_xref="InterPro:IPR041472"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ7"
FT                   /protein_id="BAH48674.1"
FT                   /translation="MAHLLLVESWVGAMGTLLPRAVAELGAEFTFLTRRPEHYPQSAPD
FT                   GLPHPLRLGRGVVTAETNDPATALAAARTLHADTPIDGVLTSCDYYLPLAARIAAELGL
FT                   PGPTPAAVVAACNKALTRAALDRCDVPGPRHVTVPADDQQRLRTGAEMVGFPLVLKPTD
FT                   LCAGMFVRRVEDWAALDTAARDLLRFEVNARGQRREPVVLLEEFLEGPEFSVESWIRDG
FT                   EVHTVGVTDKSLGGASGFVETGHMFPADVGDQDHARLVAAAEAAIRAVGLDHGVVHTEL
FT                   RLTAAGPRIIEINPRPAGNQITELIRHVTGIDLPRIAVELALGREPALPTVPNGQRGGS
FT                   RALSAAVSMLVPARAGILTGIEGTEAVAADPAVIAATFKAPGHRTTVGVDNNSYLGSVI
FT                   ALSHEQSGARRLAEGLLSAVSARYEEPAP"
     gtggcacacc tactcttggt cgagagctgg gtcggcgcga tggggacgtt gctgccgagg        60
     gcggttgccg agctgggcgc cgagttcacg ttcctgacac ggcggcccga gcactatcca       120
     caatcagccc ccgacggatt accgcacccg cttcgcctcg gccggggtgt ggtgaccgcc       180
     gagacgaacg acccggcaac ggcactcgcc gctgcccgca cactccatgc ggacacgccg       240
     atcgacggtg tcctcaccag ttgtgactat tacctgcccc tggcggcgcg gatcgccgcc       300
     gagctgggat taccgggtcc gaccccagcc gctgtggtgg ccgcctgtaa caaggcgctg       360
     acccgagcgg cgttggaccg gtgcgatgtg ccggggccgc gccacgtcac cgtgccggcc       420
     gacgaccagc agcgactacg caccggggcc gagatggtgg gttttccgct ggtgctcaag       480
     ccgaccgacc tgtgtgccgg gatgttcgtg cgacgcgtcg aggactgggc ggcgctcgat       540
     acggcggccc gcgatttgct ccggttcgag gtcaatgcgc gcgggcagcg gcgggaaccg       600
     gtggtgttgc tcgaggagtt tctcgagggg ccggagttca gtgtggagag ctggattcgg       660
     gacggcgagg tccacacggt cggcgtcacc gacaagagcc tcggcggtgc gtcgggtttc       720
     gtggagaccg ggcacatgtt cccggccgac gtcggcgacc aggatcatgc gcggcttgtt       780
     gccgccgcgg aggcggcgat tcgtgcggtg ggcctcgatc acggtgtggt gcacaccgaa       840
     ctgcggctga ccgcggccgg gccgcgcatc atcgagatca atccgcggcc cgcgggaaat       900
     cagatcaccg agctgatcag gcacgtcacc ggcatcgacc tgccgcgcat cgcggtggag       960
     ctggcactgg gacgcgagcc ggccctcccg acggtgccga atgggcagcg aggcgggtcg      1020
     cgggcgctga gtgcagcggt gagcatgctg gtgccggcga gggcgggaat tctgaccggc      1080
     atcgagggga cggaggcggt cgctgccgat ccggcggtga tcgcggcgac gttcaaggcg      1140
     cctggtcacc gaaccacggt gggcgtggac aacaacagct atctgggcag cgtcattgcc      1200
     ctctcccatg agcagtcggg ggcccgccgg ctcgccgagg ggttgctgtc cgctgtctct      1260
     gccaggtacg aggagcctgc gccgtga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page