(data stored in ACNUC7421 zone)

EMBL: AP011115.PE428

AP011115.PE428       Location/Qualifiers
FT   CDS_pept        437694..438536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48675"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ8"
FT                   /protein_id="BAH48675.1"
FT                   /translation="MTPGAKTNAHTGPAAALLDRYRTDPALIPPAAVMVSTAFTTFQGV
FT                   RHSGRSAGYRNQVISLRVGGATGSCAVEPGSVDPDVIHACAGVPVAELLRHDELAVRVA
FT                   ALDSYLAHQRPHAFDSRADTVHVAPGDSLQRSLARARAVTGLLDAPRQGRVLVIGVVNS
FT                   LLACLRERDLRYVPCDLKGGKTEWGEPIVTEFADGLDDCDAVLASGMMLGNGTLDRLLE
FT                   LVAASGRAVPVALFAQSGAAVARELLGHGVDALSAEPYPFFWLTGDTSTIHLYRAQPR"
     gtgacccctg gcgcaaagac caatgcacac actggacccg cagccgcgct tctcgaccgt        60
     taccgcaccg acccggcact gataccgccc gccgccgtca tggtgtcgac ggcgttcacc       120
     accttccagg gggttcggca cagcgggcgc agcgcaggct accgaaacca ggtgatcagc       180
     ctgcgcgtag gcggcgcgac cggttcgtgc gccgtcgaac caggttcggt ggatccggac       240
     gtcattcatg cctgcgccgg ggtgccggtg gccgaattgc tccgccacga cgaactcgcc       300
     gttcgggtcg cggcgctgga ctcctacctg gcgcaccaac gtccgcacgc gttcgattcc       360
     cgcgccgaca ccgtccatgt ggcaccggga gattcgctgc agcgttccct cgctcgggcc       420
     cgggcggtga cgggtcttct cgacgcaccg cgacagggcc gggtgttggt gatcggggtc       480
     gtcaactcgc tgctggcctg cctgcgcgag cgcgacctgc ggtatgtgcc atgcgatctg       540
     aagggcggca aaaccgagtg gggtgagccg atcgtcaccg aattcgccga tggtttggac       600
     gattgcgatg cggtgctggc cagcgggatg atgctcggca acggcaccct cgatcgactc       660
     ctcgagctgg tcgcggcgtc cggccgggcg gtcccggtcg ccctcttcgc gcagagcggg       720
     gcggcggtgg cccgcgaact actcgggcac ggggtcgatg cgctctcggc cgagccgtat       780
     ccgttcttct ggctcaccgg cgacaccagc accatccacc tgtaccgggc gcagccgcgg       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page