(data stored in ACNUC7421 zone)

EMBL: AP011115.PE429

AP011115.PE429       Location/Qualifiers
FT   CDS_pept        438533..439606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04290"
FT                   /product="putative cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="protein synonym:O-acetylserine (thiol)-lyase"
FT                   /note="protein synonym:O-acetylserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48676"
FT                   /db_xref="GOA:C1ARJ9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ9"
FT                   /protein_id="BAH48676.1"
FT                   /translation="MTVIEPRWRVGHSPLVRITTPVPRRHPGYFAKIESLGLGGLKARS
FT                   ALSMLVGARRRGELRPGARVVESTSGTLGVGLAYVAQSLGHPVTLVVDGELEPAMRNLL
FT                   RALGATLEIVERPHPEGGWQQARLDRLSRILATDAGAYWPNQYDNPDNAAGYHGLADEI
FT                   VAGLAAVGIDRADVLVCSVGTGGHSSGVGLRLRQVWPGLRIIGVDALGSKIFGQPAGRR
FT                   LMRGLGSSVHPGNVRYEMFDEVHWVGPREAVHACRALARGGFHTGGWSTGAAATVAGWA
FT                   AAQGSGSVVTIFPDGPDRYLRTIFDDDWCRGRGLLDPPRTQPHEIDDCRDHTECWTRCQ
FT                   SVLAPHSLAGDGTKAAG"
     gtgaccgtca tcgaaccacg ctggcgcgtc ggacacagcc cactcgtgcg gatcaccacc        60
     ccggtgcccc gccgccaccc cggctacttc gcgaagatcg agtccctcgg tttgggtggt       120
     ctcaaggccc gctcggcact ctcgatgctg gtgggcgcgc gccggcgggg cgagctgcgg       180
     ccgggtgccc gggtggtcga atccaccagc ggcactctgg gagtcgggct ggcgtacgtg       240
     gcgcagtcgc tggggcaccc ggtgacgctc gtggtcgatg gcgaactcga accggcgatg       300
     cggaacctgt tgcgggcgtt aggtgccacc ttggaaatcg tggagcgccc gcaccccgag       360
     ggtggatggc aacaggcaag actcgaccga ttgagccgca tcctggccac cgacgccggg       420
     gcgtattggc cgaatcagta cgacaacccg gacaacgccg cgggctatca cggactcgcc       480
     gacgagatcg tcgccggtct ggccgcggtg ggcatcgacc gggccgatgt cctggtgtgc       540
     agcgtgggca cgggcgggca cagcagcggg gtcggactcc ggttgcggca ggtgtggccg       600
     ggcctgcgga tcatcggcgt cgacgcgttg gggtcgaaga tcttcggcca gcccgcggga       660
     cggcgcctga tgcgcggatt ggggagcagt gtgcacccgg gcaatgtgcg gtacgagatg       720
     ttcgacgagg tgcactgggt gggcccgcgc gaggccgtgc acgcctgccg tgccctggcc       780
     cgaggcggat tccacaccgg cggctggtcc accggcgcgg ccgccacggt ggccgggtgg       840
     gcggccgccc aggggtcggg cagcgtggtc accatcttcc cggacggccc ggaccgctac       900
     cttcgcacca tcttcgacga cgactggtgt cgcgggcgcg gactgctcga tccaccgcgc       960
     acccaaccgc acgagatcga cgactgccga gatcacaccg agtgctggac ccgatgccag      1020
     tcggtgctcg caccacactc actggccggc gacggtacga aggccgcggg atga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page