(data stored in ACNUC7421 zone)

EMBL: AP011115.PE433

AP011115.PE433       Location/Qualifiers
FT   CDS_pept        442783..444360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04330"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48680"
FT                   /db_xref="GOA:C1ARK3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK3"
FT                   /protein_id="BAH48680.1"
FT                   /translation="MNPVPRSPLSPLPYLSRRSFLGLGAAATGAVLIGACSTGDTGTQV
FT                   TSTPRDGGRLRAVFAGGGAQEVLDPHKTNLYADVARSNALYDKLVEYGDDLGPVPRLAT
FT                   AWRPNADATTWTVQLRPAVFHDGRPVRAADVLYSYQRILDPKNALRPRASLEVIDIARS
FT                   RQVDDRSIEFVCTRPCGDLANVLAAFGAYIIPEGTTDFTAPIGSGPFTFVSFAPGRSFV
FT                   AARFGDYWDGPPHVEQLEILTAPDETARINALLGGQVEYADDLGVTSARTYETDARVQI
FT                   LRSPRSAMSGFAMKVDRPPFDNLDLRRAMFALTDRDELVSTVLGSTGVVGNDLFGKDTK
FT                   YYATDLPQRSLDLDDAKTLIRKAGAQNTTIELQTTGATNGFVEAANILAEQAARAGLTI
FT                   DVKVGEGSTYWTRTLDEGVLSSFRSGAMPIETHLAQRMLSTSSKNYTQWRRPDFDALFA
FT                   TASETTDEAVRARAYRDMQSQLYTEGGLLVWGFSDGLHGLAPNLAGMARSAPSNTLGYA
FT                   RFDKAWLS"
     atgaatccgg tcccccgatc acccctgtcc ccgctgccgt atctgagccg gcgatccttc        60
     ctcggactcg gcgccgccgc caccggggcg gtgctgatcg gcgcctgcag cacgggcgac       120
     accggcaccc aggtcacctc gaccccccgc gacggcggcc ggttgcgggc ggtgttcgcc       180
     ggcggcggtg cacaggaggt cctcgacccg cacaagacca acctctacgc cgacgtcgcg       240
     cggtcgaatg cgctctacga caagctcgtc gagtacggcg acgacctcgg cccggtaccc       300
     cgactcgcca ccgcctggcg accgaatgcc gacgccacca cgtggacggt gcagctgcgc       360
     cccgcggtgt tccacgacgg ccggccggtg cgggcggcgg acgtcctgta ctcctaccag       420
     cgcatcctcg acccgaagaa cgcgctgcgc ccgcgcgcct cgctcgaggt gatcgacatc       480
     gcccgatccc ggcaggtcga cgatcgcagc atcgaattcg tgtgcacccg gccctgcggg       540
     gacctggcca atgtgctggc cgcgttcggt gcctacatca tcccggaggg caccaccgac       600
     ttcaccgcac cgatcggttc cgggccgttc accttcgtct cgttcgcgcc gggccgctcg       660
     ttcgtcgccg cccgattcgg cgactactgg gacggccccc cgcatgtcga gcagctcgaa       720
     atcctcaccg ccccggacga aacggcccgc atcaacgccc tgctcggcgg gcaggtggag       780
     tacgccgacg acctcggtgt cacctcggcc cgcacctacg aaaccgatgc ccgggtgcag       840
     atcctacggt ccccgcgcag cgcgatgtcg gggttcgcga tgaaggtgga ccggcccccg       900
     ttcgacaacc tggacctgcg acgggcgatg ttcgccctca ccgaccggga cgaactggtc       960
     tccaccgtgc tcggcagcac cggggtggtc ggcaacgacc tgttcggcaa ggacacgaag      1020
     tactacgcca ccgacctgcc ccagcgcagc ctggacctcg atgacgccaa gacactgatc      1080
     cgcaaggccg gcgcccagaa cacgaccatc gagctgcaga ccaccggggc caccaacgga      1140
     ttcgtcgagg ccgccaacat cctcgccgaa caggccgcac gagcgggact gacgatcgac      1200
     gtgaaagtcg gtgagggttc cacctattgg acccggaccc tcgacgaggg ggtgctgtcg      1260
     agcttccgct cgggtgccat gcccatcgag acgcacctgg cgcagcggat gctgtccacc      1320
     tcgtcgaaga actacaccca gtggcgccgc cccgacttcg atgcactgtt cgcgaccgcg      1380
     agtgagacca ctgacgaggc ggtgcgggcc cgcgcttacc gggacatgca gtcccagctg      1440
     tacaccgagg gcggactgct ggtgtggggg ttctccgacg gcctgcacgg actggccccg      1500
     aacctggccg ggatggcccg cagcgccccc agcaacaccc tcgggtacgc ccgcttcgac      1560
     aaggcctggc tgtcgtga                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page