(data stored in ACNUC7421 zone)

EMBL: AP011115.PE434

AP011115.PE434       Location/Qualifiers
FT   CDS_pept        444357..445307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04340"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48681"
FT                   /db_xref="GOA:C1ARK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK4"
FT                   /protein_id="BAH48681.1"
FT                   /translation="MILTRYAGMRVALGLAQVLGVLVVVFLVASVLPGDAAVVIAADDA
FT                   DPARIAQLRETLGLDRPLLVQLGDWLAGLPRADLGTSAVSGRPVAEILSAALVPTLTLA
FT                   ALALAVLIPLAVGLGVAAAVGRGRRVDRTISGVVVALYAVPEFALAIVLVAVFAVGLGL
FT                   FAPTAVGAGGPLLWQPELWVLPVAVLVIRPVCSLSRLVRASMITTLESDYIRHTLRLGV
FT                   PGRRVVWRHALPGSLTPAAAHLARVADWLLGGVVVVEAVFALGGLGQVLVSAVSSRDIP
FT                   LLMGLAALFAVITVAVNTIADIVAFRLTPTAGGTS"
     gtgatcctca cccggtacgc cgggatgcgg gtggcgctcg ggctggctca ggtgctcggt        60
     gtcctcgtcg tcgtgttcct ggtggcgtcg gtgctgcccg gggacgccgc ggtggtgatc       120
     gccgcagacg acgccgaccc cgcgcggatt gcgcagctgc gggaaaccct ggggctggac       180
     cggccgctgc tcgtacaact cggcgactgg ctggccgggc tgccccgggc cgatctgggt       240
     acctccgcgg tctccggtcg cccggtcgcc gagatactgt ccgcggcact ggtaccgacg       300
     ctcaccctcg ccgctctcgc cctggcggtg ctgattccgc tggcggtggg attgggggtg       360
     gccgccgcgg tcggacgcgg ccggcgggtc gaccggacga tctccggggt agtggtggcg       420
     ctgtatgcgg tgcccgagtt tgctctggcg atcgtgctgg tcgccgtgtt cgcggtcggg       480
     ttggggctct tcgcccccac cgcggtcggt gccggcgggc ccctgctgtg gcagccggag       540
     ctgtgggtac tgccggtagc ggtgctggtg atccgtccgg tctgctcgct gtcgcgactg       600
     gtgcgcgcat cgatgatcac caccctcgaa tccgactaca tccggcacac cctgcggttg       660
     ggggtgccgg gccgccgggt ggtgtggcgg cacgccctac ccggctcgct cacccccgcc       720
     gccgcgcacc tcgcgcgggt ggcggactgg ctgctcggcg gggtcgtcgt cgtcgaagcg       780
     gtcttcgcgc tcggcggcct cggacaggtg ttggtcagcg cggtcagcag ccgcgacatc       840
     ccgctactga tgggcctggc cgctctgttc gctgtcatca ccgtcgcggt gaacacgatc       900
     gcggacatcg tggccttccg gctcaccccc accgcaggcg gcacatcatg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page