(data stored in ACNUC7421 zone)

EMBL: AP011115.PE435

AP011115.PE435       Location/Qualifiers
FT   CDS_pept        445304..446140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04350"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48682"
FT                   /db_xref="GOA:C1ARK5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK5"
FT                   /protein_id="BAH48682.1"
FT                   /translation="MTAPGRVLSRLPRQRYLVGLLLTAIPLLIAVLGPLIAEPAGRGPA
FT                   FTLGENWLLGTDSEGRDVLNQLLLGGRSLVSVATAAVLVTYLLAVPWGVAAATTRRRIV
FT                   DEALMRPLDLLLSLPSMLLLLLVVALTGADTLVLAVTVAVLLFPDAARMVRASALHAAH
FT                   TPAMEALGLQRETWWRRNIGYLGRSLLPVLAADAGLRFVGAIYLVASASFLGLTADSTG
FT                   TDWAVMIDRNRSGIALVPWGVVVPAVMIIALAMGVNLLFDAGARAATDHSSPKDPE"
     atgaccgccc ccggacgggt gttgagccga cttccgagac agcgctacct cgtcggtttg        60
     ctgctcactg ccatcccgtt gctgatcgcg gtcctgggac cgctgatcgc cgagccggcc       120
     ggccgcggcc cggcattcac cctcggcgaa aactggctcc tcggcaccga ctccgagggc       180
     cgggacgtcc tcaaccaact tctgctcggc ggccggtcac tggtgtcggt ggccaccgcg       240
     gcggtcctgg tcacctacct actcgcggtg ccctgggggg tggcggccgc caccacgcgg       300
     cgccggattg tcgacgaagc gctgatgcgc ccactggatc tgctgctgtc gctgccctcg       360
     atgctgctgc tactcctggt ggtcgccctc accggcgccg acacgctcgt gttggcggtg       420
     acggtggctg ttctgctgtt cccggacgcg gcccggatgg tgcgagcctc ggcgctacac       480
     gccgcacaca ccccggcgat ggaggcactg gggctgcaac gcgaaacgtg gtggcgccgc       540
     aacatcggct acctggggcg ttcgctgctc cccgtgctcg cggccgacgc cgggctgcgg       600
     ttcgtcgggg cgatctacct ggtggcctcc gcgagctttc tcgggttgac cgccgattcc       660
     accggcaccg actgggccgt gatgatcgac cgcaaccgca gcggcatcgc cctcgtgccc       720
     tggggtgtcg tcgtccccgc ggtgatgatc atcgcgctgg ccatgggcgt gaatctgctg       780
     ttcgacgcgg gcgcccgcgc cgcaaccgac cactcgtccc cgaaggatcc ggaatga          837
//

If you have problems or comments...

PBIL Back to PBIL home page