(data stored in ACNUC7421 zone)

EMBL: AP011115.PE436

AP011115.PE436       Location/Qualifiers
FT   CDS_pept        446137..447576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04360"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48683"
FT                   /db_xref="GOA:C1ARK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK6"
FT                   /protein_id="BAH48683.1"
FT                   /translation="MTDTVQELHTRPSVIRVRGLTATTRDRTLIAGIDLDIPGGLVTAI
FT                   IGSSGSGKTTTALALMGEHRPGVTLSMDCRDTAGARFGYVPQQPSSVLSPFLRIGAVLR
FT                   DIERAARRAGHKVSVPDALQRAGFPSDPVMLRRYPHQLSGGQQQRLVIAHALLTNPTCL
FT                   IMDEPTTGQDPANRAAVLDEITRLSRQGLTVVLLTHDLDAVRAVAQKVIVMAHGHIVEA
FT                   GDAGVLDGSVHEQTRALVDAQSRLRRHRPSRHPSGRRGTRLTVDAVTADFRKSSILHDF
FT                   SLSLDPGECVALVGPSGCGKTTAARVIAGLHQPAAGRVVLDGCALAGATRRRTRQQVAA
FT                   IAYVFQDAKAAFDPYRSVWEQIVRGPLQLRGATHAEATAAAGTALDQVGLDKRIARQRP
FT                   YALSGGEAQRAAIARALAVAPSVLMCDEVTTGLDTVSQRRVLDILSELTRARNVSLLMI
FT                   SHDAAVVHAVADQVVDMAGAH"
     atgaccgaca cagtgcagga actccacacg cggcccagcg tcatccgggt gcgcgggctc        60
     accgcgacaa cccgggaccg gaccctgatc gcgggcatcg acctcgatat ccctggcggc       120
     ctggtcaccg cgatcatcgg cagctccggc agcggaaaga caaccaccgc actggcactg       180
     atgggtgagc accggcccgg ggtaaccctg tcgatggact gccgcgacac cgcgggggca       240
     cggttcgggt acgttccgca acaaccgtcc tcggtactga gtccgttcct gcggatcggc       300
     gcggtcctgc gcgacatcga acgcgccgcg cgccgggcgg gacacaaggt ctcggtgccc       360
     gatgcactgc agcgagcggg tttcccgagc gatccggtca tgctgcgccg ctacccgcac       420
     caactgtccg gtggtcaaca gcaacgactg gtcatcgccc acgccctgct gacgaacccg       480
     acctgcctga tcatggacga gccgaccacc ggtcaagacc cggcgaaccg ggcggccgtc       540
     ctcgacgaga tcacccggct gtcacggcag ggcctgacgg tcgtactcct cactcacgac       600
     ctcgatgccg tccgcgccgt ggctcagaag gtgatcgtca tggcgcacgg tcacattgtc       660
     gaggcaggcg atgccggagt cctcgacggc tcggtgcacg agcagacgag agcgttggtc       720
     gatgcgcagt cccggctgag gcggcacaga ccgagccgtc atccttccgg ccggcgaggt       780
     acccgcttga ctgtggacgc ggtgacggcc gatttccgca aaagcagtat attgcatgat       840
     ttttcgctgt cgctcgaccc aggtgagtgc gtggcactgg tgggcccatc cggttgcggg       900
     aaaaccaccg cggcccgggt catcgcagga ctgcaccagc cggcggccgg gcgggtggta       960
     ctagacggtt gcgctctggc gggagccacc cggaggcgga cgcggcagca ggtcgcggcg      1020
     atcgcctacg tgtttcagga cgccaaggct gctttcgacc cgtaccgaag tgtgtgggag      1080
     cagatcgtgc gcggaccact acagttgcgc ggcgccaccc acgccgaggc aacggcggcg      1140
     gcggggacgg cgctcgatca ggtagggctg gacaagcgga tcgcacgtca gcgcccgtat      1200
     gccctctccg gcggcgaggc gcagcgcgca gcgatcgcgc gggcactggc ggtggcgccg      1260
     tcggtcctga tgtgcgacga ggtgaccacg ggactcgaca ccgtatcgca gcgtcgagtc      1320
     ctcgacatcc tgtccgaact cactcgcgca cggaatgttt cgctgttgat gatcagccac      1380
     gacgcggcgg tggtgcacgc cgtcgccgac caggtcgtcg acatggcggg agcgcactga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page