(data stored in ACNUC7421 zone)

EMBL: AP011115.PE438

AP011115.PE438       Location/Qualifiers
FT   CDS_pept        complement(449824..450108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48685"
FT                   /db_xref="InterPro:IPR009963"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK8"
FT                   /protein_id="BAH48685.1"
FT                   /translation="MALHILLVKAASTVVTGAVGVAAYNAARKVVAKAPLHEAAVTATA
FT                   WGLRGARKAEEGAESARLKVSDVVAEARGRIGEEVPPPPDPEIGHGHNH"
     atggcccttc acattctgct cgtcaaggcc gcctctaccg tggtaaccgg cgccgtcggt        60
     gtcgccgcct acaacgcggc ccgcaaggtc gtcgcgaagg cgccgctgca cgaggcggcg       120
     gtcaccgcga ccgcgtgggg actgcgcggt gcccgtaagg cggaggaggg cgccgagtcg       180
     gcacggctga aggtctccga cgtggtcgcc gaggccagag gccggatcgg tgaagaggtg       240
     ccgccaccgc cggatcctga aatcggtcac ggccacaatc actga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page