(data stored in ACNUC7421 zone)

EMBL: AP011115.PE44

AP011115.PE44        Location/Qualifiers
FT   CDS_pept        complement(36522..37019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48291"
FT                   /db_xref="GOA:C1AS42"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS42"
FT                   /protein_id="BAH48291.1"
FT                   /translation="MSGAGNRLITPMLATPGEPPVEMDGWAAEMKYDGFRLLAGVGGAH
FT                   PVLWTRNLNVVTSSYPEVTEALTEAFGGHGRIVFDGEIVALTQGRPSFARLQKRANTLR
FT                   PTTTLRRQVPVTFLPFDVLYRTSELGHPRLVWLLLRDAHFRCASADSGLLDVDWRVPGV
FT                   NG"
     atgagcggag ctgggaatcg gctgatcacg ccgatgctgg ccacaccggg tgaaccaccg        60
     gtggaaatgg acgggtgggc agccgaaatg aagtacgacg gcttccgcct attagctggg       120
     gtcggtggcg cgcatccggt gctgtggacc cgcaacctca acgttgtcac ttcctcctac       180
     ccggaggtga ccgaggcgct gaccgaggca ttcggtggtc acgggcgcat cgtcttcgac       240
     ggtgaaatcg tcgccctcac gcaaggtcgg ccttcgttcg cacgcctgca gaagcgggcg       300
     aacaccctgc gcccgaccac caccctgcgt cggcaggtac cggtcacctt cctgccgttc       360
     gacgtgcttt accggactag cgaactcgga cacccgcgac ttgtgtggtt gttgctccgc       420
     gacgcccatt ttcgatgcgc atcggctgac tctggtttgt tggacgtcga ctggcgcgtc       480
     cccggagtca acgggtag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page