(data stored in ACNUC7421 zone)

EMBL: AP011115.PE440

AP011115.PE440       Location/Qualifiers
FT   CDS_pept        450482..451993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04400"
FT                   /product="drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48687"
FT                   /db_xref="GOA:C1ARL0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL0"
FT                   /protein_id="BAH48687.1"
FT                   /translation="MRSERSASLGVFMKTASPRTHYQLTFTVLTIGVGAFALLQSLLMP
FT                   VLPTLESALGTTQADVTWVLTAYLLSASIFTPVMGRLGDMHGKKRVFVLALAALAVGSL
FT                   LAALATSLPVMIAARAIQGIGGGVLPLAFGIIRDEFPEEKVAGAVGVIAALTAVGAGLG
FT                   IVLAGPIVTVLSYHWLFWIPLIMVVLAGAAAQMLIPESPVRTAGKINWLTALLLSGWLV
FT                   TLLLGVSQAPAWGWGSPIVVGLLVAAAVIVVTWVAAEARSSNPLIDMQMMRVRSVWAAN
FT                   LLALLMGVGMYAAFGFLPQFLQTPTAAGYGFGASVTESGLMLLPLSVGMFLLGLASGRL
FT                   AARLGSKCLLIAGSVVSAIGYFVVAFAHQTETEIYLATSLIGIGFGLAFSAMSNVVVAA
FT                   VPSEQTGVASGMNANIRTIGGSLGAALMASIVTAGASAEGVPPESGYTHGFVVLGTAVG
FT                   LGAVAAMFIPAMKRGDITRLEESTALRHPELAMVAGGTLVGDEPE"
     atgcggagtg aacgctccgc ttcgttggga gtattcatga aaaccgcttc gccgcggacg        60
     cactatcaat tgacatttac cgttctcacc atcggtgtcg gcgccttcgc tcttctgcag       120
     tcgctgttga tgccggtgct gcccactctc gagtccgcac tgggcacaac ccaggccgac       180
     gtcacgtggg tattgactgc ttacctgttg tcggcgtcga tcttcacccc ggtcatggga       240
     cgcctcggcg acatgcacgg caagaagcgt gtcttcgtcc ttgcgctcgc tgcactggcg       300
     gtggggtctc tcctcgccgc actcgccaca tctctgccgg tgatgatcgc ggcccgggcg       360
     atccagggca tcggcggcgg agtgctgccc ctggcgttcg gcatcatccg tgacgagttc       420
     cccgaggaga aggtggcggg cgcagtcggt gtcatcgccg cactcaccgc tgtcggcgca       480
     ggtctcggca tcgttctcgc cggccccatc gtgaccgtgc tgagttacca ctggctgttc       540
     tggattccgc tgatcatggt cgtcctcgcg ggggcggccg cgcagatgct gatccccgag       600
     tctccggtcc gcaccgcggg aaagatcaac tggctcaccg cactactgct ctccgggtgg       660
     ctggtcacgc tcctgctcgg tgtgagtcag gcacccgcgt ggggttgggg ctctccgatc       720
     gtcgtcggcc ttctggtggc ggccgcggtc atcgtcgtga cgtgggttgc cgccgaggca       780
     cggtcttcca acccgctgat cgacatgcag atgatgcggg tccgcagcgt ctgggcggcc       840
     aacctgttgg ctctactgat gggcgtcggc atgtacgccg cattcggctt cctaccacag       900
     tttctgcaga cgcccacggc cgccggatac ggcttcggcg cttcggtcac cgagtcgggt       960
     ctgatgctgc tgcccctgag cgtgggaatg ttcctactcg gactcgcctc cggccgcctg      1020
     gcggctcgcc tgggttcgaa atgcctactg atcgcggggt ctgtcgtgag tgcgatcggc      1080
     tacttcgtgg tggcgtttgc acatcagacc gagaccgaga tctacctcgc cacgtcattg      1140
     atcggaatcg gtttcggact tgccttctcg gcgatgtcga acgtcgtggt cgcggcggtg      1200
     ccgtccgaac agaccggtgt cgccagcggt atgaacgcga acatccgcac gatcggcggg      1260
     tcactgggcg ctgcactcat ggccagcatc gtcacggccg gcgcgtccgc cgagggcgtt      1320
     ccgccggaat ccggttacac ccatggattc gtcgtgctcg gcacagcagt gggcctcggc      1380
     gcagttgcgg cgatgttcat cccggcgatg aaacggggcg acatcacgcg tctcgaagag      1440
     tcgaccgcac tgcggcaccc ggaactcgcc atggtcgcgg gaggcactct ggtgggagac      1500
     gaacccgaat ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page